Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5587
Gene name
Locationscaffold_460:3594..4958
Strand+
Gene length (bp)1364
Transcript length (bp)1194
Coding sequence length (bp)1191
Protein length (aa) 397

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16899 Cyclin_C_2 Cyclin C-terminal domain 4.7E-30 156 262

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P37366|CCL1_YEAST Cyclin CCL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCL1 PE=1 SV=1 3 266 1.0E-33
sp|P36613|CGM2_SCHPO Cyclin mcs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcs2 PE=1 SV=1 6 213 4.0E-31
sp|P51946|CCNH_HUMAN Cyclin-H OS=Homo sapiens GN=CCNH PE=1 SV=1 8 329 3.0E-25
sp|Q4R7U4|CCNH_MACFA Cyclin-H OS=Macaca fascicularis GN=CCNH PE=2 SV=1 8 214 3.0E-25
sp|Q3ZBL9|CCNH_BOVIN Cyclin-H OS=Bos taurus GN=CCNH PE=2 SV=1 8 214 3.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P37366|CCL1_YEAST Cyclin CCL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCL1 PE=1 SV=1 3 266 1.0E-33
sp|P36613|CGM2_SCHPO Cyclin mcs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcs2 PE=1 SV=1 6 213 4.0E-31
sp|P51946|CCNH_HUMAN Cyclin-H OS=Homo sapiens GN=CCNH PE=1 SV=1 8 329 3.0E-25
sp|Q4R7U4|CCNH_MACFA Cyclin-H OS=Macaca fascicularis GN=CCNH PE=2 SV=1 8 214 3.0E-25
sp|Q3ZBL9|CCNH_BOVIN Cyclin-H OS=Bos taurus GN=CCNH PE=2 SV=1 8 214 3.0E-25
sp|Q61458|CCNH_MOUSE Cyclin-H OS=Mus musculus GN=Ccnh PE=1 SV=2 8 329 4.0E-25
sp|Q9R1A0|CCNH_RAT Cyclin-H OS=Rattus norvegicus GN=Ccnh PE=1 SV=2 8 329 6.0E-25
sp|Q55F19|CCNH_DICDI Putative cyclin-H OS=Dictyostelium discoideum GN=cycH PE=3 SV=1 8 213 9.0E-24
sp|P51947|CCNH_XENLA Cyclin-H OS=Xenopus laevis GN=ccnh PE=1 SV=1 8 214 3.0E-17
sp|Q9GP34|CCNH_ECHMU Probable cyclin-H OS=Echinococcus multilocularis GN=CYCH PE=2 SV=1 8 311 9.0E-17
sp|Q8W5S1|CCH11_ARATH Cyclin-H1-1 OS=Arabidopsis thaliana GN=CYCH1-1 PE=1 SV=1 42 292 4.0E-14
sp|Q10D80|CCH11_ORYSJ Cyclin-H1-1 OS=Oryza sativa subsp. japonica GN=CYCH1-1 PE=1 SV=1 8 213 4.0E-13
sp|Q9C1M4|SSN8_GIBMO RNA polymerase II holoenzyme cyclin-like subunit OS=Gibberella moniliformis GN=SSN8 PE=1 SV=1 8 236 2.0E-07
sp|Q9FJK7|CCC12_ARATH Cyclin-C1-2 OS=Arabidopsis thaliana GN=CYCC1-2 PE=2 SV=1 54 161 5.0E-07
sp|Q86KE7|CCNC_DICDI Cyclin-C OS=Dictyostelium discoideum GN=cycC PE=3 SV=1 48 161 6.0E-06
sp|P55168|CCNC_CHICK Cyclin-C OS=Gallus gallus GN=CCNC PE=3 SV=1 36 161 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5587
MATEDERYRQSSQFRLWSFSTASLQDLRAKTNRMAKQQVAARTEATLEFLTPDEESRLVKFFTIELIRAAQFCEL
PTEIRSTAAIFLRRFYITNSVMTYPPTELLKTCLFFGCKAEGFYIRLAKLAEKFPNTTSEQILAGEFLLCQGIRF
AFDVRHPFRALEGAILELRRLRPDEEARIIKAHAHARETLKFSALVTDAYFHFTPSQIMMAALLMVDSGLVDILI
PKPKASGDAGSDEASRVSTGVYDKIMTTIESCRAMLEDEPPERMTDYWATGETVKSMKPLRKKLQKCRDPDRADL
VALQRARREQAVAKPSKTPGAAVANDGMVFGTSNSRDAKRRKLEANDEPFGPSHFSDFDSIDEDVAHPETLGFTA
DLWVVTTPETRPVEGDGTRQMR
Coding >Ophio5|5587
ATGGCTACGGAAGATGAGCGCTACCGTCAGTCGAGCCAATTCCGCCTCTGGTCCTTCTCGACAGCCAGCTTGCAA
GATCTACGGGCCAAGACGAACAGGATGGCAAAGCAGCAGGTCGCTGCTCGTACCGAAGCAACCCTCGAATTCTTG
ACTCCAGACGAAGAGTCGCGCCTCGTCAAATTCTTCACAATCGAGCTCATCCGTGCCGCCCAGTTCTGCGAATTG
CCCACCGAGATCCGCTCGACCGCGGCCATTTTCCTACGACGCTTCTACATTACCAACTCCGTCATGACGTATCCG
CCGACGGAGCTGCTCAAGACATGCCTGTTCTTTGGTTGTAAGGCAGAGGGCTTCTATATCCGCCTTGCCAAGCTA
GCGGAAAAGTTTCCCAACACCACGAGCGAGCAGATTCTGGCCGGTGAATTCCTACTATGCCAGGGCATTCGCTTC
GCATTCGATGTCCGCCATCCTTTCCGCGCCTTGGAAGGCGCCATACTGGAGTTGCGCCGCCTTCGGCCGGACGAG
GAGGCTCGGATCATCAAAGCGCATGCGCACGCCAGGGAGACGCTCAAGTTCAGCGCTCTGGTGACGGATGCTTAC
TTTCACTTCACCCCCAGCCAGATCATGATGGCTGCTCTACTCATGGTAGATTCCGGTTTGGTCGACATTTTGATA
CCCAAACCCAAGGCCAGCGGGGACGCCGGCTCAGACGAAGCCTCACGAGTCTCGACGGGCGTATACGACAAGATA
ATGACGACTATCGAAAGCTGTCGCGCCATGCTGGAAGATGAGCCTCCGGAGAGGATGACCGATTACTGGGCCACT
GGGGAAACTGTGAAATCCATGAAACCGCTTCGTAAAAAGCTGCAAAAATGTCGAGACCCGGACAGGGCCGATCTG
GTGGCACTGCAGCGGGCCAGACGCGAACAAGCAGTGGCCAAGCCTTCGAAGACGCCTGGAGCGGCTGTGGCAAAC
GACGGGATGGTTTTCGGAACCAGCAACTCTAGAGACGCGAAACGAAGAAAGTTGGAAGCCAACGACGAACCTTTT
GGCCCTTCACATTTCTCGGACTTTGACTCGATTGACGAGGATGTCGCCCACCCAGAAACCTTGGGCTTTACTGCG
GATCTTTGGGTAGTGACGACGCCCGAGACACGTCCCGTCGAAGGCGACGGAACTAGACAAATGCGA
Transcript >Ophio5|5587
ATGGCTACGGAAGATGAGCGCTACCGTCAGTCGAGCCAATTCCGCCTCTGGTCCTTCTCGACAGCCAGCTTGCAA
GATCTACGGGCCAAGACGAACAGGATGGCAAAGCAGCAGGTCGCTGCTCGTACCGAAGCAACCCTCGAATTCTTG
ACTCCAGACGAAGAGTCGCGCCTCGTCAAATTCTTCACAATCGAGCTCATCCGTGCCGCCCAGTTCTGCGAATTG
CCCACCGAGATCCGCTCGACCGCGGCCATTTTCCTACGACGCTTCTACATTACCAACTCCGTCATGACGTATCCG
CCGACGGAGCTGCTCAAGACATGCCTGTTCTTTGGTTGTAAGGCAGAGGGCTTCTATATCCGCCTTGCCAAGCTA
GCGGAAAAGTTTCCCAACACCACGAGCGAGCAGATTCTGGCCGGTGAATTCCTACTATGCCAGGGCATTCGCTTC
GCATTCGATGTCCGCCATCCTTTCCGCGCCTTGGAAGGCGCCATACTGGAGTTGCGCCGCCTTCGGCCGGACGAG
GAGGCTCGGATCATCAAAGCGCATGCGCACGCCAGGGAGACGCTCAAGTTCAGCGCTCTGGTGACGGATGCTTAC
TTTCACTTCACCCCCAGCCAGATCATGATGGCTGCTCTACTCATGGTAGATTCCGGTTTGGTCGACATTTTGATA
CCCAAACCCAAGGCCAGCGGGGACGCCGGCTCAGACGAAGCCTCACGAGTCTCGACGGGCGTATACGACAAGATA
ATGACGACTATCGAAAGCTGTCGCGCCATGCTGGAAGATGAGCCTCCGGAGAGGATGACCGATTACTGGGCCACT
GGGGAAACTGTGAAATCCATGAAACCGCTTCGTAAAAAGCTGCAAAAATGTCGAGACCCGGACAGGGCCGATCTG
GTGGCACTGCAGCGGGCCAGACGCGAACAAGCAGTGGCCAAGCCTTCGAAGACGCCTGGAGCGGCTGTGGCAAAC
GACGGGATGGTTTTCGGAACCAGCAACTCTAGAGACGCGAAACGAAGAAAGTTGGAAGCCAACGACGAACCTTTT
GGCCCTTCACATTTCTCGGACTTTGACTCGATTGACGAGGATGTCGCCCACCCAGAAACCTTGGGCTTTACTGCG
GATCTTTGGGTAGTGACGACGCCCGAGACACGTCCCGTCGAAGGCGACGGAACTAGACAAATGCGATGA
Gene >Ophio5|5587
ATGGCTACGGAAGATGAGCGCTACCGTCAGTCGAGCCAATTCCGCCTCTGGTCCTTCTCGACAGCCAGCTTGCAA
GATCTACGGGCCAAGACGAACAGGATGGCAAAGCAGCAGGTCGCTGCTCGTACCGAAGCAACCCTCGAATTCTTG
ACTCCAGACGAAGAGTCGCGCCTCGTCAAATTCTTCACAATCGAGCTCATCCGTGCCGCCCAGTTCTGCGAATTG
CCCACCGAGATCCGCTCGACCGCGGCCATTTTCCTACGACGCTTCTACATTACCAACTCCGTCATGACGTATCCG
CCGACGGAGCTGCTCAAGACATGCCTGTTCTTTGGTTGTAAGGCAGAGGGCTTCTATATCCGCCTTGCCAAGCTA
GCGGAAAAGTTTCCCAACACCACGAGCGAGCAGATTCTGGCCGGTGAATTCCTACTATGCCAGGGCATTCGCTTC
GCATTCGATGTCCGCCATCCTTTCCGCGCCTTGGAAGGCGCCATACTGGAGTTGCGCCGCCTTCGGCCGGACGAG
GAGGCTCGGATCATCAAAGCGCATGCGCACGCCAGGGAGACGCTCAAGTTCAGCGCTCTGGTGACGGATGCTTAC
TTTCACTTCACCCCCAGCCAGATCATGATGGCTGCTCTACTCATGGTAGATTCCGGTTTGGTCGACATTTTGATA
CCCAAACCCAAGGCCAGCGGGGACGCCGGCTCAGACGAAGCCTCACGAGTCTCGACGGGCGTATACGACAAGATA
ATGACGACTATCGAAAGCTGTCGCGCCATGCTGGAAGATGAGCCTCCGGAGAGGATGACCGATTACTGGGCCACT
GTGCGCACACCCTGAACCGTAACCCCGTCTTCTACTGACTTGAACAGGGGGAAACTGTGAAATCCATGAAACCGC
TTCGTAAAAAGCTGCAAAAATGTCGAGACCCGGACAGGGCCGATCTGGTGGCACTGCAGCGGGCCAGACGCGAAC
AAGCAGTGGCCAAGCCTTCGAAGACGCCTGGAGCGGCTGTGGCAAACGACGGGATGGTTTTCGGAACCAGCAACT
CTAGAGACGCGAAACGAAGAAAGTTGGAAGCCAACGACGAACCTTTTGGCCCTTCGTTAGTGGGTTGATGGGCCT
CGCCTTTACTTCGAGATGGTGATATATTTCGTCACGCGGGAAACACAGACATTTCTCGGACTTTGACTCGATTGA
CGAGGATGTCGCCCACCCAGAAACCTTGGGCTTTACTGCGGATCTTTGGGTAGTGACGACGCCCGAGACACGTCC
CGTCGAGTGAGTGGTTGCGCTATCCCGCTCTCTCCCTATCTAACAACTCGGTTGGCCGCAGAGGCGACGGAACTA
GACAAATGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail