Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5583
Gene name
Locationscaffold_46:55994..59024
Strand+
Gene length (bp)3030
Transcript length (bp)2883
Coding sequence length (bp)2880
Protein length (aa) 960

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74910|RAF1_SCHPO Rik1-associated factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=raf1 PE=1 SV=1 176 754 4.0E-20
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 400 745 6.0E-06

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3733 0.889 0.1523 0.0137 0.0983 0.0072 0.0466 0.0253 0.0244 0.0059

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2550
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1390
Ophiocordyceps australis map64 (Brazil) OphauB2|3696
Ophiocordyceps camponoti-floridani Ophcf2|01580
Ophiocordyceps camponoti-rufipedis Ophun1|1217
Ophiocordyceps kimflemingae Ophio5|5583 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3777

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5583
MQTLIDLTGDDESALESKAIAVPRDGSPPAKRRRSDAAAFRSFKLQVVERRRVVVGPGPCRVGDEARGRPLVVDE
AEAEAGSFDVQPKSGPNAHVIEQARAVKPQAAPQVVKGLASKRCPDGPTRFLQPRRSGAQPAANKWFRLEELPYL
PAADRDLIVEGSRQPIPRVSDVPKWPLVYHVDFTADEVDQILTHLSELLLEELPKTIRCLTALCFRHHVPSLVGH
VLPRRRAQDVHNFCADLMAGRAADPRHARTLSLDRPVKGGRQRERQCGRISSLLLAREMEGNAGFGRMRQYANLQ
NDFTKTREDLLAVVAEFTNCAGDISTMSWVSDGNVLCGTTAHSDAHNQQYNKPGNLVLGSTQRGTLQAMAHHRIP
RPRVEKGDNASEAMRQSQDPWLYCSVVSSDYDAVRRRAYTSSFDWTVKVWQVEDDGSTMACVATWHHGGNVNFVE
AAPDGSGRVASAADVPSQAVRVYSVRDDDVDGSPYQAISCTRADADGCDSWAYFPATMQWGRAPGTTQLLMVGYS
PRGRTEDHDIPEDKRNTGEIMLWDAARGHRVPVLTATTANVFEVAWHPTMRRFIVATSPSGLPTEKKGIRTQIRI
FQEDRDRLDGAYSEFQKLDCVAADINELTFMPNSLHHAYITAGCTDGHVYVWDTAQGDDPIHVLRHGYPLDEFSY
DREKEDTGVKFTAWGASPDRLYTGSSDGVVKVWNVRNRGDPFVRDLLEAPGPISVGAFSPDHARLAVGDATGRVF
LLSVDERDEHPAHLMAAPGCPNRRVRRPRPFTPHPEPEPPPPAADDEGESRSWSTTIASYARNTYLDTKQLTLHA
NPVIGAVQGPSYASTALFRREAHLDEDPFAPLLTEYERLQRDACRGRAVRPLRRLRDPLASEGEAADDDGEGAAR
RGDQHAANTRLDVEGLKLLASDVWDCLCREGAVLSDVTGEDWGFVYEEGPATPPEEGTRV
Coding >Ophio5|5583
ATGCAAACCTTGATCGACCTGACGGGCGACGATGAGTCGGCGCTAGAGTCAAAGGCTATCGCGGTGCCGAGAGAC
GGTAGCCCTCCGGCCAAGAGGCGGCGGTCGGACGCGGCCGCGTTTCGGAGCTTCAAGCTGCAGGTTGTTGAGCGG
CGGCGCGTCGTGGTCGGTCCTGGTCCGTGTCGGGTTGGAGACGAGGCTCGGGGACGCCCCCTCGTTGTCGACGAG
GCTGAGGCTGAGGCTGGGTCTTTCGATGTTCAGCCCAAGTCTGGGCCGAACGCTCACGTCATCGAACAGGCTCGA
GCCGTCAAGCCCCAGGCGGCACCCCAAGTCGTCAAAGGTCTCGCGTCCAAGCGTTGCCCCGATGGTCCGACTCGC
TTCCTCCAGCCTCGCCGGTCAGGGGCCCAGCCCGCAGCCAACAAGTGGTTTCGTCTCGAGGAGCTTCCCTACCTA
CCCGCGGCCGATCGCGACCTCATCGTCGAGGGATCGAGGCAGCCGATTCCGAGGGTCAGCGACGTCCCGAAATGG
CCTCTAGTCTACCACGTTGACTTTACGGCCGACGAAGTCGATCAGATACTCACGCACCTGTCGGAGCTACTGCTG
GAAGAGCTGCCCAAGACGATTCGATGTCTGACGGCTCTATGCTTCAGACACCATGTGCCGTCGCTCGTAGGCCAT
GTCCTCCCGCGACGAAGGGCACAGGATGTGCACAACTTCTGCGCCGACCTCATGGCCGGGCGGGCGGCCGACCCT
CGGCACGCCCGGACGCTATCGCTCGATAGACCAGTCAAAGGCGGACGTCAAAGGGAGCGACAGTGCGGTCGGATA
TCGTCGCTGCTCCTGGCACGCGAGATGGAGGGCAACGCCGGGTTCGGGCGGATGCGACAGTACGCCAATCTCCAA
AACGACTTCACCAAGACGCGCGAGGACTTGCTGGCGGTTGTGGCCGAGTTCACCAACTGCGCGGGCGACATCTCA
ACCATGTCGTGGGTCTCTGACGGCAACGTCCTCTGCGGCACGACGGCTCACTCCGACGCTCACAATCAGCAGTAT
AACAAGCCGGGCAACCTGGTGCTGGGCTCGACGCAACGCGGCACACTGCAGGCCATGGCCCATCACCGCATCCCG
CGGCCGCGCGTCGAAAAGGGCGACAACGCCAGCGAGGCGATGCGACAGAGCCAGGACCCGTGGCTATACTGCTCC
GTCGTGTCTTCCGACTACGACGCCGTCCGCCGGCGGGCGTATACCTCGAGCTTCGACTGGACCGTCAAGGTGTGG
CAAGTCGAGGATGACGGCTCGACCATGGCCTGCGTCGCCACTTGGCATCACGGCGGAAACGTCAACTTCGTCGAG
GCGGCGCCTGATGGCTCAGGTCGCGTCGCTTCGGCAGCAGACGTGCCTTCACAGGCGGTGCGAGTCTACAGCGTG
CGCGATGACGACGTCGACGGCAGCCCCTACCAGGCCATATCCTGTACGCGCGCCGATGCCGACGGCTGCGACTCT
TGGGCCTACTTCCCCGCCACGATGCAATGGGGTCGGGCTCCTGGGACGACGCAACTGCTCATGGTCGGCTACTCT
CCTCGCGGCCGGACCGAAGACCACGACATCCCCGAAGACAAGCGCAATACGGGCGAGATTATGCTGTGGGACGCG
GCTCGGGGCCATCGGGTGCCCGTGCTGACGGCCACGACGGCGAACGTCTTCGAGGTGGCCTGGCACCCGACGATG
CGTCGCTTCATCGTCGCCACCTCTCCCAGCGGCCTGCCGACGGAGAAGAAGGGCATCCGCACCCAGATCCGCATC
TTCCAGGAGGACCGGGATAGGCTCGACGGCGCCTACAGCGAGTTCCAGAAGCTCGACTGCGTCGCCGCCGACATC
AACGAGCTGACCTTTATGCCCAACTCGCTTCATCACGCCTACATCACTGCCGGCTGCACCGACGGCCATGTCTAC
GTCTGGGACACGGCCCAGGGCGACGACCCGATCCACGTCCTGCGTCACGGATACCCGCTCGATGAATTCTCCTAC
GACCGCGAGAAGGAGGACACGGGCGTCAAGTTTACCGCCTGGGGCGCGTCGCCCGACCGCCTGTACACGGGATCG
AGTGACGGCGTCGTCAAGGTGTGGAACGTGAGGAACAGGGGTGACCCCTTTGTCCGCGACCTGCTCGAGGCTCCC
GGCCCCATCTCCGTCGGCGCCTTTTCGCCCGACCATGCGCGCCTGGCCGTCGGAGACGCCACCGGCCGTGTCTTT
CTCCTTTCCGTCGACGAACGCGACGAGCACCCGGCTCACCTGATGGCCGCCCCGGGCTGCCCGAACCGCCGCGTG
CGCCGTCCGCGGCCCTTTACGCCGCACCCGGAGCCGGAGCCGCCTCCGCCGGCGGCGGACGACGAGGGCGAGTCA
AGGTCCTGGTCGACGACCATCGCCAGCTACGCCCGCAACACCTACCTCGACACCAAGCAGCTCACGCTACACGCC
AACCCCGTCATCGGCGCCGTCCAGGGCCCCTCGTACGCGTCCACCGCCCTCTTCCGGCGCGAGGCCCACCTGGAC
GAGGACCCTTTCGCGCCTCTCCTCACCGAGTACGAGCGCCTGCAGCGGGACGCGTGCCGGGGACGCGCCGTCCGG
CCTCTCCGCCGGCTGCGGGACCCCCTTGCTTCCGAAGGCGAAGCCGCCGACGACGACGGCGAGGGCGCGGCGCGG
CGCGGGGACCAGCACGCTGCCAATACCCGGCTTGACGTCGAGGGCTTGAAGCTACTGGCGTCGGATGTATGGGAC
TGTCTGTGCAGGGAGGGGGCCGTCTTGTCGGATGTCACGGGGGAGGATTGGGGCTTTGTCTATGAGGAGGGGCCT
GCGACTCCGCCGGAGGAGGGCACGCGTGTG
Transcript >Ophio5|5583
ATGCAAACCTTGATCGACCTGACGGGCGACGATGAGTCGGCGCTAGAGTCAAAGGCTATCGCGGTGCCGAGAGAC
GGTAGCCCTCCGGCCAAGAGGCGGCGGTCGGACGCGGCCGCGTTTCGGAGCTTCAAGCTGCAGGTTGTTGAGCGG
CGGCGCGTCGTGGTCGGTCCTGGTCCGTGTCGGGTTGGAGACGAGGCTCGGGGACGCCCCCTCGTTGTCGACGAG
GCTGAGGCTGAGGCTGGGTCTTTCGATGTTCAGCCCAAGTCTGGGCCGAACGCTCACGTCATCGAACAGGCTCGA
GCCGTCAAGCCCCAGGCGGCACCCCAAGTCGTCAAAGGTCTCGCGTCCAAGCGTTGCCCCGATGGTCCGACTCGC
TTCCTCCAGCCTCGCCGGTCAGGGGCCCAGCCCGCAGCCAACAAGTGGTTTCGTCTCGAGGAGCTTCCCTACCTA
CCCGCGGCCGATCGCGACCTCATCGTCGAGGGATCGAGGCAGCCGATTCCGAGGGTCAGCGACGTCCCGAAATGG
CCTCTAGTCTACCACGTTGACTTTACGGCCGACGAAGTCGATCAGATACTCACGCACCTGTCGGAGCTACTGCTG
GAAGAGCTGCCCAAGACGATTCGATGTCTGACGGCTCTATGCTTCAGACACCATGTGCCGTCGCTCGTAGGCCAT
GTCCTCCCGCGACGAAGGGCACAGGATGTGCACAACTTCTGCGCCGACCTCATGGCCGGGCGGGCGGCCGACCCT
CGGCACGCCCGGACGCTATCGCTCGATAGACCAGTCAAAGGCGGACGTCAAAGGGAGCGACAGTGCGGTCGGATA
TCGTCGCTGCTCCTGGCACGCGAGATGGAGGGCAACGCCGGGTTCGGGCGGATGCGACAGTACGCCAATCTCCAA
AACGACTTCACCAAGACGCGCGAGGACTTGCTGGCGGTTGTGGCCGAGTTCACCAACTGCGCGGGCGACATCTCA
ACCATGTCGTGGGTCTCTGACGGCAACGTCCTCTGCGGCACGACGGCTCACTCCGACGCTCACAATCAGCAGTAT
AACAAGCCGGGCAACCTGGTGCTGGGCTCGACGCAACGCGGCACACTGCAGGCCATGGCCCATCACCGCATCCCG
CGGCCGCGCGTCGAAAAGGGCGACAACGCCAGCGAGGCGATGCGACAGAGCCAGGACCCGTGGCTATACTGCTCC
GTCGTGTCTTCCGACTACGACGCCGTCCGCCGGCGGGCGTATACCTCGAGCTTCGACTGGACCGTCAAGGTGTGG
CAAGTCGAGGATGACGGCTCGACCATGGCCTGCGTCGCCACTTGGCATCACGGCGGAAACGTCAACTTCGTCGAG
GCGGCGCCTGATGGCTCAGGTCGCGTCGCTTCGGCAGCAGACGTGCCTTCACAGGCGGTGCGAGTCTACAGCGTG
CGCGATGACGACGTCGACGGCAGCCCCTACCAGGCCATATCCTGTACGCGCGCCGATGCCGACGGCTGCGACTCT
TGGGCCTACTTCCCCGCCACGATGCAATGGGGTCGGGCTCCTGGGACGACGCAACTGCTCATGGTCGGCTACTCT
CCTCGCGGCCGGACCGAAGACCACGACATCCCCGAAGACAAGCGCAATACGGGCGAGATTATGCTGTGGGACGCG
GCTCGGGGCCATCGGGTGCCCGTGCTGACGGCCACGACGGCGAACGTCTTCGAGGTGGCCTGGCACCCGACGATG
CGTCGCTTCATCGTCGCCACCTCTCCCAGCGGCCTGCCGACGGAGAAGAAGGGCATCCGCACCCAGATCCGCATC
TTCCAGGAGGACCGGGATAGGCTCGACGGCGCCTACAGCGAGTTCCAGAAGCTCGACTGCGTCGCCGCCGACATC
AACGAGCTGACCTTTATGCCCAACTCGCTTCATCACGCCTACATCACTGCCGGCTGCACCGACGGCCATGTCTAC
GTCTGGGACACGGCCCAGGGCGACGACCCGATCCACGTCCTGCGTCACGGATACCCGCTCGATGAATTCTCCTAC
GACCGCGAGAAGGAGGACACGGGCGTCAAGTTTACCGCCTGGGGCGCGTCGCCCGACCGCCTGTACACGGGATCG
AGTGACGGCGTCGTCAAGGTGTGGAACGTGAGGAACAGGGGTGACCCCTTTGTCCGCGACCTGCTCGAGGCTCCC
GGCCCCATCTCCGTCGGCGCCTTTTCGCCCGACCATGCGCGCCTGGCCGTCGGAGACGCCACCGGCCGTGTCTTT
CTCCTTTCCGTCGACGAACGCGACGAGCACCCGGCTCACCTGATGGCCGCCCCGGGCTGCCCGAACCGCCGCGTG
CGCCGTCCGCGGCCCTTTACGCCGCACCCGGAGCCGGAGCCGCCTCCGCCGGCGGCGGACGACGAGGGCGAGTCA
AGGTCCTGGTCGACGACCATCGCCAGCTACGCCCGCAACACCTACCTCGACACCAAGCAGCTCACGCTACACGCC
AACCCCGTCATCGGCGCCGTCCAGGGCCCCTCGTACGCGTCCACCGCCCTCTTCCGGCGCGAGGCCCACCTGGAC
GAGGACCCTTTCGCGCCTCTCCTCACCGAGTACGAGCGCCTGCAGCGGGACGCGTGCCGGGGACGCGCCGTCCGG
CCTCTCCGCCGGCTGCGGGACCCCCTTGCTTCCGAAGGCGAAGCCGCCGACGACGACGGCGAGGGCGCGGCGCGG
CGCGGGGACCAGCACGCTGCCAATACCCGGCTTGACGTCGAGGGCTTGAAGCTACTGGCGTCGGATGTATGGGAC
TGTCTGTGCAGGGAGGGGGCCGTCTTGTCGGATGTCACGGGGGAGGATTGGGGCTTTGTCTATGAGGAGGGGCCT
GCGACTCCGCCGGAGGAGGGCACGCGTGTGTGA
Gene >Ophio5|5583
ATGCAGTAAGTTAAAGCCGTGGAGACGCGTTCAGCAGGCAGCCTCTTAAGAAAAAGAGGTTGAGCGTGGCGCTTA
CGTCTACCGTTTGCAGAACCTTGATCGACCTGACGGGCGACGATGAGTCGGCGCTAGAGTCAAAGGCTATCGCGG
TGCCGAGAGACGGTAGCCCTCCGGCCAAGAGGCGGCGGTCGGACGCGGCCGCGTTTCGGAGCTTCAAGCTGCAGG
TTGTTGAGCGGCGGCGCGTCGTGGTCGGTCCTGGTCCGTGTCGGGTTGGAGACGAGGTGAGGCAGAGAAAACCCG
TGCCGAGGCCGGTTGCGGAGCGTTTTGCTGACGCGTCGTCAGGCTCGGGGACGCCCCCTCGTTGTCGACGAGGCT
GAGGCTGAGGCTGGGTCTTTCGATGTTCAGCCCAAGTCTGGGCCGAACGCTCACGTCATCGAACAGGCTCGAGCC
GTCAAGCCCCAGGCGGCACCCCAAGTCGTCAAAGGTCTCGCGTCCAAGCGTTGCCCCGATGGTCCGACTCGCTTC
CTCCAGCCTCGCCGGTCAGGGGCCCAGCCCGCAGCCAACAAGTGGTTTCGTCTCGAGGAGCTTCCCTACCTACCC
GCGGCCGATCGCGACCTCATCGTCGAGGGATCGAGGCAGCCGATTCCGAGGGTCAGCGACGTCCCGAAATGGCCT
CTAGTCTACCACGTTGACTTTACGGCCGACGAAGTCGATCAGATACTCACGCACCTGTCGGAGCTACTGCTGGAA
GAGCTGCCCAAGACGATTCGATGTCTGACGGCTCTATGCTTCAGACACCATGTGCCGTCGCTCGTAGGCCATGTC
CTCCCGCGACGAAGGGCACAGGATGTGCACAACTTCTGCGCCGACCTCATGGCCGGGCGGGCGGCCGACCCTCGG
CACGCCCGGACGCTATCGCTCGATAGACCAGTCAAAGGCGGACGTCAAAGGGAGCGACAGTGCGGTCGGATATCG
TCGCTGCTCCTGGCACGCGAGATGGAGGGCAACGCCGGGTTCGGGCGGATGCGACAGTACGCCAATCTCCAAAAC
GACTTCACCAAGACGCGCGAGGACTTGCTGGCGGTTGTGGCCGAGTTCACCAACTGCGCGGGCGACATCTCAACC
ATGTCGTGGGTCTCTGACGGCAACGTCCTCTGCGGCACGACGGCTCACTCCGACGCTCACAATCAGCAGTATAAC
AAGCCGGGCAACCTGGTGCTGGGCTCGACGCAACGCGGCACACTGCAGGCCATGGCCCATCACCGCATCCCGCGG
CCGCGCGTCGAAAAGGGCGACAACGCCAGCGAGGCGATGCGACAGAGCCAGGACCCGTGGCTATACTGCTCCGTC
GTGTCTTCCGACTACGACGCCGTCCGCCGGCGGGCGTATACCTCGAGCTTCGACTGGACCGTCAAGGTGTGGCAA
GTCGAGGATGACGGCTCGACCATGGCCTGCGTCGCCACTTGGCATCACGGCGGAAACGTCAACTTCGTCGAGGCG
GCGCCTGATGGCTCAGGTCGCGTCGCTTCGGCAGCAGACGTGCCTTCACAGGCGGTGCGAGTCTACAGCGTGCGC
GATGACGACGTCGACGGCAGCCCCTACCAGGCCATATCCTGTACGCGCGCCGATGCCGACGGCTGCGACTCTTGG
GCCTACTTCCCCGCCACGATGCAATGGGGTCGGGCTCCTGGGACGACGCAACTGCTCATGGTCGGCTACTCTCCT
CGCGGCCGGACCGAAGACCACGACATCCCCGAAGACAAGCGCAATACGGGCGAGATTATGCTGTGGGACGCGGCT
CGGGGCCATCGGGTGCCCGTGCTGACGGCCACGACGGCGAACGTCTTCGAGGTGGCCTGGCACCCGACGATGCGT
CGCTTCATCGTCGCCACCTCTCCCAGCGGCCTGCCGACGGAGAAGAAGGGCATCCGCACCCAGATCCGCATCTTC
CAGGAGGACCGGGATAGGCTCGACGGCGCCTACAGCGAGTTCCAGAAGCTCGACTGCGTCGCCGCCGACATCAAC
GAGCTGACCTTTATGCCCAACTCGCTTCATCACGCCTACATCACTGCCGGCTGCACCGACGGCCATGTCTACGTC
TGGGACACGGCCCAGGGCGACGACCCGATCCACGTCCTGCGTCACGGATACCCGCTCGATGAATTCTCCTACGAC
CGCGAGAAGGAGGACACGGGCGTCAAGTTTACCGCCTGGGGCGCGTCGCCCGACCGCCTGTACACGGGATCGAGT
GACGGCGTCGTCAAGGTGTGGAACGTGAGGAACAGGGGTGACCCCTTTGTCCGCGACCTGCTCGAGGCTCCCGGC
CCCATCTCCGTCGGCGCCTTTTCGCCCGACCATGCGCGCCTGGCCGTCGGAGACGCCACCGGCCGTGTCTTTCTC
CTTTCCGTCGACGAACGCGACGAGCACCCGGCTCACCTGATGGCCGCCCCGGGCTGCCCGAACCGCCGCGTGCGC
CGTCCGCGGCCCTTTACGCCGCACCCGGAGCCGGAGCCGCCTCCGCCGGCGGCGGACGACGAGGGCGAGTCAAGG
TCCTGGTCGACGACCATCGCCAGCTACGCCCGCAACACCTACCTCGACACCAAGCAGCTCACGCTACACGCCAAC
CCCGTCATCGGCGCCGTCCAGGGCCCCTCGTACGCGTCCACCGCCCTCTTCCGGCGCGAGGCCCACCTGGACGAG
GACCCTTTCGCGCCTCTCCTCACCGAGTACGAGCGCCTGCAGCGGGACGCGTGCCGGGGACGCGCCGTCCGGCCT
CTCCGCCGGCTGCGGGACCCCCTTGCTTCCGAAGGCGAAGCCGCCGACGACGACGGCGAGGGCGCGGCGCGGCGC
GGGGACCAGCACGCTGCCAATACCCGGCTTGACGTCGAGGGCTTGAAGCTACTGGCGTCGGATGTATGGGACTGT
CTGTGCAGGGAGGGGGCCGTCTTGTCGGATGTCACGGGGGAGGATTGGGGCTTTGTCTATGAGGAGGGGCCTGCG
ACTCCGCCGGAGGAGGGCACGCGTGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail