Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5578
Gene name
Locationscaffold_46:41868..42796
Strand-
Gene length (bp)928
Transcript length (bp)774
Coding sequence length (bp)771
Protein length (aa) 257

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09430 EMC7_beta-sandw ER membrane protein complex subunit 7, beta-sandwich domain 5.3E-23 46 171

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VY97|Y4213_ARATH ER membrane protein complex subunit 7 homolog OS=Arabidopsis thaliana GN=At4g32130 PE=2 SV=1 73 206 1.0E-10
sp|Q9EP72|EMC7_MOUSE ER membrane protein complex subunit 7 OS=Mus musculus GN=Emc7 PE=1 SV=1 67 198 7.0E-08
sp|Q9NPA0|EMC7_HUMAN ER membrane protein complex subunit 7 OS=Homo sapiens GN=EMC7 PE=1 SV=1 67 198 9.0E-08
sp|A5PJA8|EMC7_BOVIN ER membrane protein complex subunit 7 OS=Bos taurus GN=EMC7 PE=2 SV=1 67 198 9.0E-08
sp|Q0IHY5|EMC7_XENTR ER membrane protein complex subunit 7 OS=Xenopus tropicalis GN=emc7 PE=2 SV=1 67 198 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VY97|Y4213_ARATH ER membrane protein complex subunit 7 homolog OS=Arabidopsis thaliana GN=At4g32130 PE=2 SV=1 73 206 1.0E-10
sp|Q9EP72|EMC7_MOUSE ER membrane protein complex subunit 7 OS=Mus musculus GN=Emc7 PE=1 SV=1 67 198 7.0E-08
sp|Q9NPA0|EMC7_HUMAN ER membrane protein complex subunit 7 OS=Homo sapiens GN=EMC7 PE=1 SV=1 67 198 9.0E-08
sp|A5PJA8|EMC7_BOVIN ER membrane protein complex subunit 7 OS=Bos taurus GN=EMC7 PE=2 SV=1 67 198 9.0E-08
sp|Q0IHY5|EMC7_XENTR ER membrane protein complex subunit 7 OS=Xenopus tropicalis GN=emc7 PE=2 SV=1 67 198 1.0E-07
sp|Q4R5V2|EMC7_MACFA ER membrane protein complex subunit 7 OS=Macaca fascicularis GN=EMC7 PE=2 SV=1 67 198 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 158 180 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 136.69 74.69 198.70
CcL In ants, during behavior modification 184.59 95.32 273.85
CcD In ants, recently dead 150.73 81.53 219.93

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.203598 no
SC16a CcD 0.714058 no
CcL CcD 0.420575 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5578
MPPSIQATMPPSIQHVLHLLLTLTSLPLVLGGTSLTLYLPASTSPHRLATRTHATLSSLGLHRAAPLSVTNAFVF
RNVTPGSYLVDVHCPSLAFRPLRVDVGRGDEGQDGAVAAWETFRGNDWANKGEALTLLRGSDGLGFEMRPLGAKV
YFMERQGFSVLGILKSPMILMGLVGMLMVFGMPYLMENMDPEMKAEFEAQQRKGGPVASIMGGAGPQGGNPLGDF
DMAAFLAGSKKKDTPLPLADADGPSRQQGVRR
Coding >Ophio5|5578
ATGCCGCCCTCGATCCAAGCCACGATGCCGCCCTCGATCCAACACGTGCTGCACCTGCTACTCACCCTCACATCC
CTCCCTCTCGTTCTGGGCGGCACCTCTTTAACGCTATACCTCCCCGCGAGCACGTCACCGCACAGGCTCGCGACG
CGAACGCACGCCACGCTCTCGTCGCTGGGCCTTCACCGCGCGGCGCCGCTGTCGGTGACCAACGCCTTCGTCTTT
CGAAACGTCACGCCCGGCTCTTACCTCGTCGATGTTCACTGTCCCTCGCTGGCTTTTCGTCCGTTGCGCGTCGAC
GTCGGTCGAGGGGATGAGGGTCAGGATGGCGCCGTGGCCGCGTGGGAGACGTTTCGTGGCAATGATTGGGCGAAT
AAGGGTGAGGCTTTGACCTTACTCAGGGGTTCTGATGGCTTGGGCTTCGAGATGAGGCCGCTGGGGGCCAAGGTT
TACTTTATGGAGCGTCAGGGCTTCTCCGTCTTAGGCATCCTCAAAAGCCCCATGATACTCATGGGCCTCGTCGGC
ATGCTCATGGTTTTCGGCATGCCCTACCTCATGGAGAACATGGACCCCGAGATGAAAGCCGAGTTCGAAGCCCAG
CAGCGCAAAGGCGGTCCCGTAGCCAGCATCATGGGCGGCGCCGGGCCGCAGGGAGGCAACCCCCTCGGCGATTTC
GACATGGCTGCTTTCCTCGCCGGCTCCAAGAAGAAGGATACGCCGCTGCCGCTTGCTGATGCGGATGGCCCTTCT
AGGCAGCAGGGTGTGCGAAGA
Transcript >Ophio5|5578
ATGCCGCCCTCGATCCAAGCCACGATGCCGCCCTCGATCCAACACGTGCTGCACCTGCTACTCACCCTCACATCC
CTCCCTCTCGTTCTGGGCGGCACCTCTTTAACGCTATACCTCCCCGCGAGCACGTCACCGCACAGGCTCGCGACG
CGAACGCACGCCACGCTCTCGTCGCTGGGCCTTCACCGCGCGGCGCCGCTGTCGGTGACCAACGCCTTCGTCTTT
CGAAACGTCACGCCCGGCTCTTACCTCGTCGATGTTCACTGTCCCTCGCTGGCTTTTCGTCCGTTGCGCGTCGAC
GTCGGTCGAGGGGATGAGGGTCAGGATGGCGCCGTGGCCGCGTGGGAGACGTTTCGTGGCAATGATTGGGCGAAT
AAGGGTGAGGCTTTGACCTTACTCAGGGGTTCTGATGGCTTGGGCTTCGAGATGAGGCCGCTGGGGGCCAAGGTT
TACTTTATGGAGCGTCAGGGCTTCTCCGTCTTAGGCATCCTCAAAAGCCCCATGATACTCATGGGCCTCGTCGGC
ATGCTCATGGTTTTCGGCATGCCCTACCTCATGGAGAACATGGACCCCGAGATGAAAGCCGAGTTCGAAGCCCAG
CAGCGCAAAGGCGGTCCCGTAGCCAGCATCATGGGCGGCGCCGGGCCGCAGGGAGGCAACCCCCTCGGCGATTTC
GACATGGCTGCTTTCCTCGCCGGCTCCAAGAAGAAGGATACGCCGCTGCCGCTTGCTGATGCGGATGGCCCTTCT
AGGCAGCAGGGTGTGCGAAGATAG
Gene >Ophio5|5578
ATGCCGCCCTCGATCCAAGCCACGATGCCGCCCTCGATCCAACACGTGCTGCACCTGCTACTCACCCTCACATCC
CTCCCTCTCGTTCTGGGCGGCACCTCTTTAACGCTATACCTCCCCGCGAGCACGTCACCGCACAGGCTCGCGACG
CGAACGCACGCCACGCTCTCGTCGCTGGGCCTTCACCGCGCGGCGCCGCTGTCGGTGACCAACGCCTTCGTCTTT
CGAAACGTCACGCCCGGCTCTTACCTCGTCGATGTTCACTGTCCCTCGCTGGCTTTTCGTCCGTTGCGCGTCGAC
GTCGGTCGAGGGGATGAGGGTCAGGATGGCGCCGTGGCCGCGTGGGAGACGTTTCGTGGCAATGATTGGGCGAAT
AAGGGTGAGGCTTTGACCTTACTCAGGGGTTCTGATGGCTTGGGCTTCGAGATGAGGCCGCTGGGGGCCAAGGTT
TACTTTATGGAGCGTCAGGGCTGTGAGCTTTCCCGCCTCCCCCCTCTTTCTTCCCTCCTTGGCGTGTTTTCCAAG
CTGACCTTGGGCTTGTCTCCATCAGTCTCCGTCTTAGGCATCCTCAAAAGCCCCATGATACTCATGGGCCTCGTC
GGCATGCTCATGGTTTTCGGCATGCCCTACCTCATGGAGAACAGTACGATGGCTCCCCTCCTTCATCTTCCCGGC
CATCCATCCTCTCAAGATCGCCGACTAACACCCCCTCCAACCAGTGGACCCCGAGATGAAAGCCGAGTTCGAAGC
CCAGCAGCGCAAAGGCGGTCCCGTAGCCAGCATCATGGGCGGCGCCGGGCCGCAGGGAGGCAACCCCCTCGGCGA
TTTCGACATGGCTGCTTTCCTCGCCGGCTCCAAGAAGAAGGATACGCCGCTGCCGCTTGCTGATGCGGATGGCCC
TTCTAGGCAGCAGGGTGTGCGAAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail