Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5576
Gene name
Locationscaffold_46:37390..39755
Strand+
Gene length (bp)2365
Transcript length (bp)2145
Coding sequence length (bp)2142
Protein length (aa) 714

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04515 Choline_transpo Plasma-membrane choline transporter 1.4E-18 414 534

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74441|CTL1_SCHPO Choline transporter-like protein ctl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctl1 PE=1 SV=1 305 535 8.0E-17

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 298 320 22
2 340 362 22
3 369 391 22
4 406 425 19
5 452 474 22
6 494 516 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5576
MFSEYASRFLAQSQSRLSNLGQPDGDHPSRPNEWASSRPGRSQRDAARANQPSRNILSRGYGGNPYQQNGTGSRF
GHLGFASRISAAQEAPLFHSTLDEFREEDDEEEREREAADLFALQRSRRVAAASKLAESAESGASHASMGESATA
AEYPYPSHALARGIKSSWNGARSTHQHRRLSHDALTEDELHPPSSPDDDDAASHGPDGKGKMVDIGLESQEDGDG
DPPESLLGGEAPADPSTPPFQSFKPASEREPFISKRSSVDSDPDSPRRRYYNETEAGQARNRSVEGELFKHDPFF
AWIFLISLAGMMSTFILVWLHTSPRKSPVGDTIYTTLQKSFDMLAVDTIVSVFVSLIWLAALRSFVRPLVSVILV
AVPVIMLSFSLYPFVSSFQGRTQGVSVQDSVMRWASLVPAGACVLWLWLVVKGRRAIQQAIEMLQFSSRILAQNP
GLLAVGFGCLGLIVLWTWAWLAMFTRVFMGGYFSKSLVRFVIQLSSWWLGAAFILMYLWTLAVINAVHRATTAAT
VSQWYFHRNAGPVTSSRDIHLPVDTAGAPAEGASALPTATGGHGPGQPGGLLGADADDGADEPADGDVLGHPLAE
PGDVGSGAGPDGRGISDDGDDDADAPSATGSRRGGQRAAPLPAGEAAPGGDALRHGDRAGLRRMGHDGQAAADPA
PGRDGGARVGRRMERGQGRFCLEAAYLFGEGRPGEGGYV
Coding >Ophio5|5576
ATGTTCTCGGAGTACGCCTCACGCTTTCTAGCACAGTCACAGTCCCGGCTGTCTAACCTGGGCCAGCCCGACGGC
GATCATCCGTCACGGCCCAACGAATGGGCTTCGTCGAGGCCGGGCCGCTCGCAGCGAGACGCGGCCCGAGCCAAC
CAGCCCTCGAGGAATATACTCTCCCGAGGCTACGGCGGGAACCCCTACCAGCAGAATGGCACCGGCTCGCGTTTC
GGCCACTTGGGATTTGCGTCGCGCATCTCTGCCGCCCAGGAAGCGCCGCTCTTTCACAGCACCCTCGACGAGTTT
CGCGAGGAGGACGATGAGGAGGAGCGGGAACGGGAGGCCGCTGACCTGTTCGCGCTGCAGCGCTCCCGGCGCGTC
GCCGCTGCTAGCAAGCTCGCCGAAAGCGCAGAGTCCGGTGCCAGCCACGCGTCCATGGGCGAGAGCGCCACCGCC
GCCGAGTACCCTTATCCGAGTCACGCCCTGGCTCGTGGCATCAAGAGCAGCTGGAACGGTGCCCGGAGCACACAT
CAGCACCGTCGCCTATCGCACGACGCCCTGACCGAGGATGAGCTGCACCCACCGTCATCTCCAGACGATGATGAC
GCCGCCAGCCACGGTCCCGACGGCAAGGGAAAGATGGTGGACATCGGACTGGAGTCGCAAGAGGACGGCGACGGC
GATCCGCCCGAGTCTCTCCTCGGCGGAGAGGCACCCGCCGACCCGAGTACGCCGCCTTTCCAATCTTTCAAGCCG
GCGTCGGAGCGGGAGCCCTTCATCTCCAAGAGAAGCTCCGTCGACTCGGATCCCGACAGTCCGCGCCGTCGCTAC
TACAACGAGACCGAGGCGGGACAGGCGAGGAACCGTTCGGTCGAAGGCGAGCTGTTCAAACACGATCCCTTCTTC
GCCTGGATCTTCCTCATCAGTCTCGCCGGCATGATGTCCACCTTTATCCTCGTCTGGCTGCACACGTCTCCACGC
AAGAGCCCCGTCGGCGACACCATCTACACAACACTGCAAAAGTCGTTTGACATGCTGGCCGTCGACACCATCGTC
TCCGTCTTCGTGTCGCTGATATGGCTGGCCGCCCTGCGGTCCTTTGTCAGGCCGCTCGTCAGCGTCATCCTGGTG
GCGGTGCCCGTCATCATGCTATCCTTTTCACTCTACCCCTTCGTCTCGTCCTTCCAAGGGCGGACGCAGGGTGTC
AGCGTCCAGGACAGCGTGATGCGGTGGGCGTCGCTGGTGCCGGCCGGCGCTTGCGTCCTTTGGCTCTGGCTCGTC
GTTAAGGGGCGTCGGGCCATCCAACAGGCCATCGAGATGCTGCAGTTCTCGTCCAGGATTCTGGCGCAGAACCCG
GGCCTGCTGGCCGTCGGCTTCGGTTGCCTGGGCCTGATTGTTCTGTGGACGTGGGCTTGGCTGGCCATGTTCACG
CGCGTCTTCATGGGCGGCTACTTTTCCAAGTCGCTGGTGCGGTTCGTGATCCAGCTGTCGAGCTGGTGGCTGGGC
GCGGCCTTTATCCTCATGTATCTGTGGACCCTGGCCGTCATCAACGCGGTTCACCGGGCGACGACGGCGGCGACG
GTTTCGCAGTGGTACTTTCATCGCAACGCGGGTCCGGTCACGTCCTCGCGCGACATCCATCTGCCAGTCGACACT
GCTGGCGCTCCTGCTGAGGGCGCCTCTGCTCTTCCTACCGCGACGGGTGGGCACGGCCCTGGCCAACCTGGCGGC
CTTTTGGGTGCCGACGCCGATGATGGCGCTGACGAACCCGCTGACGGTGACGTACTCGGCCATCCACTCGCAGAG
CCTGGCGACGTCGGCTCGGGGGCTGGACCGGATGGACGTGGTATCTCCGACGATGGCGACGACGACGCTGACGCC
CCGAGCGCTACGGGCTCGCGGCGGGGCGGCCAGCGGGCTGCTCCCCTACCGGCTGGCGAAGCTGCTCCTGGTGGC
GACGCGCTTCGCCATGGCGACAGGGCTGGGCTTCGCCGGATGGGTCATGACGGCCAAGCAGCTGCAGATCCAGCT
CCCGGACGGGATGGGGGTGCGCGGGTCGGCCGGAGGATGGAGAGGGGCCAAGGCCGCTTCTGTCTCGAGGCGGCT
TATCTCTTTGGCGAGGGGAGGCCGGGCGAGGGGGGATATGTC
Transcript >Ophio5|5576
ATGTTCTCGGAGTACGCCTCACGCTTTCTAGCACAGTCACAGTCCCGGCTGTCTAACCTGGGCCAGCCCGACGGC
GATCATCCGTCACGGCCCAACGAATGGGCTTCGTCGAGGCCGGGCCGCTCGCAGCGAGACGCGGCCCGAGCCAAC
CAGCCCTCGAGGAATATACTCTCCCGAGGCTACGGCGGGAACCCCTACCAGCAGAATGGCACCGGCTCGCGTTTC
GGCCACTTGGGATTTGCGTCGCGCATCTCTGCCGCCCAGGAAGCGCCGCTCTTTCACAGCACCCTCGACGAGTTT
CGCGAGGAGGACGATGAGGAGGAGCGGGAACGGGAGGCCGCTGACCTGTTCGCGCTGCAGCGCTCCCGGCGCGTC
GCCGCTGCTAGCAAGCTCGCCGAAAGCGCAGAGTCCGGTGCCAGCCACGCGTCCATGGGCGAGAGCGCCACCGCC
GCCGAGTACCCTTATCCGAGTCACGCCCTGGCTCGTGGCATCAAGAGCAGCTGGAACGGTGCCCGGAGCACACAT
CAGCACCGTCGCCTATCGCACGACGCCCTGACCGAGGATGAGCTGCACCCACCGTCATCTCCAGACGATGATGAC
GCCGCCAGCCACGGTCCCGACGGCAAGGGAAAGATGGTGGACATCGGACTGGAGTCGCAAGAGGACGGCGACGGC
GATCCGCCCGAGTCTCTCCTCGGCGGAGAGGCACCCGCCGACCCGAGTACGCCGCCTTTCCAATCTTTCAAGCCG
GCGTCGGAGCGGGAGCCCTTCATCTCCAAGAGAAGCTCCGTCGACTCGGATCCCGACAGTCCGCGCCGTCGCTAC
TACAACGAGACCGAGGCGGGACAGGCGAGGAACCGTTCGGTCGAAGGCGAGCTGTTCAAACACGATCCCTTCTTC
GCCTGGATCTTCCTCATCAGTCTCGCCGGCATGATGTCCACCTTTATCCTCGTCTGGCTGCACACGTCTCCACGC
AAGAGCCCCGTCGGCGACACCATCTACACAACACTGCAAAAGTCGTTTGACATGCTGGCCGTCGACACCATCGTC
TCCGTCTTCGTGTCGCTGATATGGCTGGCCGCCCTGCGGTCCTTTGTCAGGCCGCTCGTCAGCGTCATCCTGGTG
GCGGTGCCCGTCATCATGCTATCCTTTTCACTCTACCCCTTCGTCTCGTCCTTCCAAGGGCGGACGCAGGGTGTC
AGCGTCCAGGACAGCGTGATGCGGTGGGCGTCGCTGGTGCCGGCCGGCGCTTGCGTCCTTTGGCTCTGGCTCGTC
GTTAAGGGGCGTCGGGCCATCCAACAGGCCATCGAGATGCTGCAGTTCTCGTCCAGGATTCTGGCGCAGAACCCG
GGCCTGCTGGCCGTCGGCTTCGGTTGCCTGGGCCTGATTGTTCTGTGGACGTGGGCTTGGCTGGCCATGTTCACG
CGCGTCTTCATGGGCGGCTACTTTTCCAAGTCGCTGGTGCGGTTCGTGATCCAGCTGTCGAGCTGGTGGCTGGGC
GCGGCCTTTATCCTCATGTATCTGTGGACCCTGGCCGTCATCAACGCGGTTCACCGGGCGACGACGGCGGCGACG
GTTTCGCAGTGGTACTTTCATCGCAACGCGGGTCCGGTCACGTCCTCGCGCGACATCCATCTGCCAGTCGACACT
GCTGGCGCTCCTGCTGAGGGCGCCTCTGCTCTTCCTACCGCGACGGGTGGGCACGGCCCTGGCCAACCTGGCGGC
CTTTTGGGTGCCGACGCCGATGATGGCGCTGACGAACCCGCTGACGGTGACGTACTCGGCCATCCACTCGCAGAG
CCTGGCGACGTCGGCTCGGGGGCTGGACCGGATGGACGTGGTATCTCCGACGATGGCGACGACGACGCTGACGCC
CCGAGCGCTACGGGCTCGCGGCGGGGCGGCCAGCGGGCTGCTCCCCTACCGGCTGGCGAAGCTGCTCCTGGTGGC
GACGCGCTTCGCCATGGCGACAGGGCTGGGCTTCGCCGGATGGGTCATGACGGCCAAGCAGCTGCAGATCCAGCT
CCCGGACGGGATGGGGGTGCGCGGGTCGGCCGGAGGATGGAGAGGGGCCAAGGCCGCTTCTGTCTCGAGGCGGCT
TATCTCTTTGGCGAGGGGAGGCCGGGCGAGGGGGGATATGTCTAG
Gene >Ophio5|5576
ATGTTCTCGGAGTGTGCGTCCGGCTCGCGGCCGTCGCGCTTTGCTTTGGTTTGCTGACGCCAGTCGTCGTCCAGA
CGCCTCACGCTTTCTAGCACAGTCACAGTCCCGGCTGTCTAACCTGGGCCAGCCCGACGGCGATCATCCGTCACG
GCCCAACGAATGGGCTTCGTCGAGGCCGGGCCGCTCGCAGCGAGACGCGGCCCGAGCCAACCAGCCCTCGAGGAA
TATACTCTCCCGAGGCTACGGCGGGAACCCCTACCAGCAGAATGGCACCGGCTCGCGTTTCGGCCACTTGGGATT
TGCGTCGCGCATCTCTGCCGCCCAGGAAGCGCCGCTCTTTCACAGCACCCTCGACGAGTTTCGCGAGGAGGACGA
TGAGGAGGAGCGGGAACGGGAGGCCGCTGACCTGTTCGCGCTGCAGCGCTCCCGGCGCGTCGCCGCTGCTAGCAA
GCTCGCCGAAAGCGCAGAGTCCGGTGCCAGCCACGCGTCCATGGGCGAGAGCGCCACCGCCGCCGAGTACCCTTA
TCCGAGTCACGCCCTGGCTCGTGGCATCAAGAGCAGCTGGAACGGTGCCCGGAGCACACATCAGCACCGTCGCCT
ATCGCACGACGCCCTGACCGAGGATGAGCTGCACCCACCGTCATCTCCAGACGATGATGACGCCGCCAGCCACGG
TCCCGACGGCAAGGGAAAGATGGTGGACATCGGACTGGAGTCGCAAGAGGACGGCGACGGCGATCCGCCCGAGTC
TCTCCTCGGCGGAGAGGCACCCGCCGACCCGAGTACGCCGCCTTTCCAATCTTTCAAGCCGGCGTCGGAGCGGGA
GCCCTTCATCTCCAAGAGAAGCTCCGTCGACTCGGATCCCGACAGTCCGCGCCGTCGCTACTACAACGAGACCGA
GGCGGGACAGGCGAGGAACCGTTCGGTCGAAGGCGAGCTGTTCAAACACGATCCCTTCTTCGCCTGGATCTTCCT
CATCAGTCTCGCCGGCATGATGTCCACCTTTATCCTCGTCTGGCTGCACACGTCTCCACGCAAGAGCCCCGTCGG
CGACACCATCTACACAACACTGCAAAAGTCGTTTGACATGCTGGCCGTCGACACCATCGTCTCCGTCTTCGTGTC
GCTGATATGGCTGGCCGCCCTGCGGTCCTTTGTCAGGCCGCTCGTCAGCGTCATCCTGGTGGCGGTGCCCGTCAT
CATGCTATCCTTTTCACTCTACCCCTTCGTCTCGTCCTTCCAAGGGCGGACGCAGGGTGTCAGCGTCCAGGACAG
CGTGATGCGGTGGGCGTCGCTGGTGCCGGCCGGCGCTTGCGTCCTTTGGCTCTGGCTCGTCGTTAAGGGGCGTCG
GGCCATCCAACAGGCCATCGAGATGCTGCAGTTCTCGTCCAGGATTCTGGCGCAGAACCCGGGCCTGCTGGCCGT
CGGCTTCGGTTGCCTGGGCCTGATTGTTCTGTGGACGTGGGCTTGGCTGGCCATGTTCACGCGCGTCTTCATGGG
CGGCTACTTTTCCAAGTCGCTGGTGCGGTTCGTGATCCAGCTGTCGAGCTGGTGGCTGGGCGCGGCCTTTATCCT
CATGTATCTGTGGACCCTGGCCGTCATCAACGCGGTTCACCGGGCGACGACGGCGGCGACGGTTTCGCAGTGGTA
CTTTCATCGCAACGCGGGTCCGGTCACGTCCTCGCGCGACATCGTGACGGCGGCGCTGGGCCACGCGACAACGAC
CATGTTCGGCAGCATCTGCCAGTCGACACTGCTGGCGCTCCTGCTGAGGGCGCCTCTGCTCTTCCTACCGCGACG
GGTGGGCACGGCCCTGGCCAACCTGGCGGCCTTTTGGGTGCCGACGCCGATGATGGCGCTGACGAACCCGCTGAC
GGTGACGTACTCGGCCATCCACTCGCAGAGCCTGGCGACGTCGGCTCGGGGGCTGGACCGGATGGACGTGGTATC
TCCGACGATGGCGACGACGACGCTGACGCCCCGAGCGCTACGGGCTCGCGGCGGGGCGGCCAGCGGGCTGCTCCC
CTACCGGCTGGCGAAGCTGCTCCTGGTGGCGACGCGCTTCGCCATGGCGACAGGGCTGGGCTTCGCCGGATGGGT
CATGACGGCCAAGCAGCTGCAGATCCAGCTCCCGGACGGGATGGGGGTGCGCGGGTCGGCGTACGCATACGTCGT
CGGCATCATGGCCAGCTTCATCGGCTATTCCGTTATGGGCGCCATGGAGGGAATCCTCAGCGGCATCGTCGACGC
CGTCCTCATCTGCTACGGGAGCGAGCGGAGGATGGAGAGGGGCCAAGGCCGCTTCTGTCTCGAGGCGGCTTATCT
CTTTGGCGAGGGGAGGCCGGGCGAGGGGGGATATGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail