Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5572
Gene name
Locationscaffold_46:28335..28662
Strand+
Gene length (bp)327
Transcript length (bp)222
Coding sequence length (bp)219
Protein length (aa) 73

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12554 MOZART1 Mitotic-spindle organizing gamma-tubulin ring associated 1.9E-23 11 57

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4QYG1|MZT1_MAGO7 Mitotic-spindle organizing protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_14000 PE=3 SV=1 5 61 3.0E-22
sp|Q5BDL9|MZT1_EMENI Mitotic-spindle organizing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1361 PE=3 SV=1 5 62 3.0E-20
sp|Q1DRC2|MZT1_COCIM Mitotic-spindle organizing protein 1 OS=Coccidioides immitis (strain RS) GN=CIMG_07141 PE=3 SV=1 1 60 7.0E-19
sp|A1CQI3|MZT1_ASPCL Mitotic-spindle organizing protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_026210 PE=3 SV=1 1 64 9.0E-19
sp|Q2GVR6|MZT1_CHAGB Mitotic-spindle organizing protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_07938 PE=3 SV=1 1 61 7.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4QYG1|MZT1_MAGO7 Mitotic-spindle organizing protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_14000 PE=3 SV=1 5 61 3.0E-22
sp|Q5BDL9|MZT1_EMENI Mitotic-spindle organizing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1361 PE=3 SV=1 5 62 3.0E-20
sp|Q1DRC2|MZT1_COCIM Mitotic-spindle organizing protein 1 OS=Coccidioides immitis (strain RS) GN=CIMG_07141 PE=3 SV=1 1 60 7.0E-19
sp|A1CQI3|MZT1_ASPCL Mitotic-spindle organizing protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_026210 PE=3 SV=1 1 64 9.0E-19
sp|Q2GVR6|MZT1_CHAGB Mitotic-spindle organizing protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_07938 PE=3 SV=1 1 61 7.0E-18
sp|A7EXZ2|MZT1_SCLS1 Mitotic-spindle organizing protein 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_10207 PE=3 SV=1 2 60 3.0E-17
sp|A6S6H9|MZT1_BOTFB Mitotic-spindle organizing protein 1 OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_08507 PE=3 SV=1 2 60 1.0E-16
sp|P0C8Y1|MZT1_DANRE Mitotic-spindle organizing protein 1 OS=Danio rerio GN=mzt1 PE=3 SV=1 2 57 2.0E-13
sp|B5FXZ4|MZT1_TAEGU Mitotic-spindle organizing protein 1 OS=Taeniopygia guttata GN=mzt1 PE=3 SV=1 9 57 4.0E-13
sp|Q0VFD6|MZT1_XENTR Mitotic-spindle organizing protein 1 OS=Xenopus tropicalis GN=mzt1 PE=3 SV=1 4 57 6.0E-13
sp|Q5U4M5|MZT1_XENLA Mitotic-spindle organizing protein 1 OS=Xenopus laevis GN=mzt1 PE=3 SV=2 4 57 7.0E-13
sp|P0CP04|MZT1_CRYNJ Mitotic-spindle organizing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNA01750 PE=3 SV=1 10 68 1.0E-12
sp|P0CP05|MZT1_CRYNB Mitotic-spindle organizing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBA1680 PE=3 SV=1 10 68 1.0E-12
sp|Q8BUR9|MZT1_MOUSE Mitotic-spindle organizing protein 1 OS=Mus musculus GN=Mzt1 PE=1 SV=1 9 57 1.0E-12
sp|Q08AG7|MZT1_HUMAN Mitotic-spindle organizing protein 1 OS=Homo sapiens GN=MZT1 PE=1 SV=2 9 57 2.0E-12
sp|P0CF96|MZT1_SCHPO Mitotic-spindle organizing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mzt1 PE=1 SV=3 9 69 4.0E-12
sp|A9NKD9|MZT1_PICSI Mitotic-spindle organizing protein 1 OS=Picea sitchensis PE=3 SV=1 10 60 4.0E-11
sp|Q9M0N8|MZT1B_ARATH Mitotic-spindle organizing protein 1B OS=Arabidopsis thaliana GN=GIP1 PE=1 SV=1 3 60 5.0E-10
sp|Q9C9T3|MZT1A_ARATH Mitotic-spindle organizing protein 1A OS=Arabidopsis thaliana GN=GIP2 PE=1 SV=1 10 64 4.0E-08
sp|B4N369|MZT1_DROWI Mitotic-spindle organizing protein 1 OS=Drosophila willistoni GN=GK12642 PE=3 SV=1 11 61 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0000931 gamma-tubulin large complex Yes
GO:0033566 gamma-tubulin complex localization Yes
GO:0031503 protein-containing complex localization No
GO:0005575 cellular_component No
GO:0000930 gamma-tubulin complex No
GO:0032991 protein-containing complex No
GO:0051179 localization No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.666 0.4692 0.052 0.0566 0.173 0.0371 0.0733 0.0523 0.0823 0.0058

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5068
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|5133
Ophiocordyceps camponoti-floridani Ophcf2|01569
Ophiocordyceps camponoti-rufipedis Ophun1|7064
Ophiocordyceps kimflemingae Ophio5|5572 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2876

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5572
MPDSDKHAAAQQAVDILHEIAIILNTNLDRRSLSICISMIERGVNPEALAQVIKELRLEAQLTSDCNASVTRP
Coding >Ophio5|5572
ATGCCCGACTCAGACAAGCACGCGGCCGCGCAACAAGCCGTCGACATCCTCCACGAGATTGCCATCATCCTGAAT
ACCAACCTGGACCGCCGCAGCCTGTCCATCTGCATCTCCATGATCGAGCGCGGCGTCAACCCGGAAGCCCTCGCG
CAAGTCATCAAAGAGTTGCGCCTCGAGGCTCAGCTCACCTCCGACTGCAACGCCTCGGTGACGCGTCCG
Transcript >Ophio5|5572
ATGCCCGACTCAGACAAGCACGCGGCCGCGCAACAAGCCGTCGACATCCTCCACGAGATTGCCATCATCCTGAAT
ACCAACCTGGACCGCCGCAGCCTGTCCATCTGCATCTCCATGATCGAGCGCGGCGTCAACCCGGAAGCCCTCGCG
CAAGTCATCAAAGAGTTGCGCCTCGAGGCTCAGCTCACCTCCGACTGCAACGCCTCGGTGACGCGTCCGTGA
Gene >Ophio5|5572
ATGCCCGACTCAGACAAGCACGCGGCCGCGCAACAAGCCGTCGACATCCTCCACGAGATTGCCATCATCCTGGTT
CGTCGTCGCTCTGCTAGTCTCTGCGCCGCCTTCGCTGACAGCCGGCCCAGAATACCAACCTGGACCGCCGCAGCC
TGTCCATCTGCATCTCCATGATCGAGCGCGGCGTCAACCCGGAAGCCCTCGCGGTGCGTCTACTCGCTCTTATTC
TCCGTCTCCTCTTCTGACGCGTCGACGCAGCAAGTCATCAAAGAGTTGCGCCTCGAGGCTCAGCTCACCTCCGAC
TGCAACGCCTCGGTGACGCGTCCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail