Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5568
Gene name
Locationscaffold_46:20662..21388
Strand-
Gene length (bp)726
Transcript length (bp)654
Coding sequence length (bp)651
Protein length (aa) 217

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06201 PITH PITH domain 6.3E-42 29 174

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VK68|PITH1_DROME PITH domain-containing protein CG6153 OS=Drosophila melanogaster GN=CG6153 PE=2 SV=1 11 200 3.0E-30
sp|Q8BWR2|PITH1_MOUSE PITH domain-containing protein 1 OS=Mus musculus GN=Pithd1 PE=1 SV=1 25 198 1.0E-29
sp|Q9GZP4|PITH1_HUMAN PITH domain-containing protein 1 OS=Homo sapiens GN=PITHD1 PE=1 SV=1 25 198 2.0E-29
sp|Q6DJI5|PITH1_XENLA PITH domain-containing protein 1 OS=Xenopus laevis GN=pithd1 PE=2 SV=1 10 198 7.0E-29
sp|Q6NYX8|PITH1_DANRE PITH domain-containing protein 1 OS=Danio rerio GN=pithd1 PE=2 SV=1 25 200 6.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VK68|PITH1_DROME PITH domain-containing protein CG6153 OS=Drosophila melanogaster GN=CG6153 PE=2 SV=1 11 200 3.0E-30
sp|Q8BWR2|PITH1_MOUSE PITH domain-containing protein 1 OS=Mus musculus GN=Pithd1 PE=1 SV=1 25 198 1.0E-29
sp|Q9GZP4|PITH1_HUMAN PITH domain-containing protein 1 OS=Homo sapiens GN=PITHD1 PE=1 SV=1 25 198 2.0E-29
sp|Q6DJI5|PITH1_XENLA PITH domain-containing protein 1 OS=Xenopus laevis GN=pithd1 PE=2 SV=1 10 198 7.0E-29
sp|Q6NYX8|PITH1_DANRE PITH domain-containing protein 1 OS=Danio rerio GN=pithd1 PE=2 SV=1 25 200 6.0E-27
sp|Q9P7A1|PITH1_SCHPO PITH domain-containing protein P35G2.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP35G2.02 PE=3 SV=1 8 196 6.0E-27
sp|Q29L80|PITH1_DROPS PITH domain-containing protein GA19395 OS=Drosophila pseudoobscura pseudoobscura GN=GA19395 PE=3 SV=1 11 199 4.0E-26
sp|Q95ZI6|PITH1_CAEEL PITH domain-containing protein ZK353.9 OS=Caenorhabditis elegans GN=ZK353.9 PE=3 SV=1 10 197 4.0E-23
sp|Q54Z24|PITH1_DICDI PITH domain-containing protein 1 OS=Dictyostelium discoideum GN=DDB_G0277951 PE=3 SV=1 1 197 4.0E-20
sp|Q8CDN6|TXNL1_MOUSE Thioredoxin-like protein 1 OS=Mus musculus GN=Txnl1 PE=1 SV=3 67 173 3.0E-16
sp|Q920J4|TXNL1_RAT Thioredoxin-like protein 1 OS=Rattus norvegicus GN=Txnl1 PE=1 SV=3 67 173 3.0E-16
sp|O43396|TXNL1_HUMAN Thioredoxin-like protein 1 OS=Homo sapiens GN=TXNL1 PE=1 SV=3 67 173 6.0E-16
sp|Q9USR1|TXL1_SCHPO Thioredoxin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=txl1 PE=3 SV=1 63 170 6.0E-15
sp|Q9SQZ9|PITH1_ARATH PITH domain-containing protein At3g04780 OS=Arabidopsis thaliana GN=At3g04780 PE=1 SV=2 23 173 2.0E-09
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.7598 0.5618 0.0371 0.0421 0.0938 0.0012 0.0941 0.085 0.0276 0.0449

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5067
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3161
Ophiocordyceps australis map64 (Brazil) OphauB2|5130
Ophiocordyceps camponoti-floridani Ophcf2|01566
Ophiocordyceps camponoti-rufipedis Ophun1|6448
Ophiocordyceps kimflemingae Ophio5|5568 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2873

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5568
MSHCHDEHHSHGHGHDHSDDITPALQSSLYEQIDFDQITTLNEATRDAGKAVVKKTWAERMEPEPELASDADEQL
LMTVPFTAQVKLHSVLVRTSLSGAAPRTLHLYVNQPRLDFSGAEELEPTQRLELAQTSEVQEVPVRRALFGKVTR
LGLLVVDNFGEDVSRLTYLGFRGEWTRLGRAPEQIVYEAAPQPGDHRIKGTGINEVGGGIGGRGHGL
Coding >Ophio5|5568
ATGTCTCACTGCCATGATGAGCACCACAGCCACGGTCACGGCCACGACCACTCAGACGACATTACGCCGGCGCTG
CAGTCGTCGCTCTACGAGCAGATTGACTTTGACCAGATCACGACGCTCAACGAAGCGACAAGGGACGCGGGCAAG
GCGGTGGTGAAGAAGACGTGGGCGGAGAGGATGGAGCCGGAACCGGAGCTGGCGAGCGATGCGGACGAGCAGCTG
CTGATGACGGTGCCATTCACGGCACAGGTGAAGCTACACTCGGTCCTCGTCCGAACTTCCCTCTCTGGCGCCGCG
CCGCGCACCCTCCACCTATACGTCAACCAACCGCGGCTCGACTTCAGCGGCGCGGAGGAGCTGGAGCCGACGCAG
CGGCTGGAGCTGGCGCAGACGTCCGAGGTGCAAGAGGTTCCAGTTCGGCGTGCCCTCTTCGGCAAGGTGACGCGG
CTGGGGTTGCTGGTGGTGGACAACTTTGGCGAGGACGTCTCGCGCCTGACGTACCTGGGCTTTCGCGGCGAGTGG
ACGAGGCTGGGGAGGGCGCCGGAGCAGATTGTCTACGAGGCGGCGCCGCAGCCTGGCGATCATCGGATCAAGGGG
ACGGGGATCAATGAGGTTGGGGGTGGGATTGGAGGGAGGGGCCATGGGTTA
Transcript >Ophio5|5568
ATGTCTCACTGCCATGATGAGCACCACAGCCACGGTCACGGCCACGACCACTCAGACGACATTACGCCGGCGCTG
CAGTCGTCGCTCTACGAGCAGATTGACTTTGACCAGATCACGACGCTCAACGAAGCGACAAGGGACGCGGGCAAG
GCGGTGGTGAAGAAGACGTGGGCGGAGAGGATGGAGCCGGAACCGGAGCTGGCGAGCGATGCGGACGAGCAGCTG
CTGATGACGGTGCCATTCACGGCACAGGTGAAGCTACACTCGGTCCTCGTCCGAACTTCCCTCTCTGGCGCCGCG
CCGCGCACCCTCCACCTATACGTCAACCAACCGCGGCTCGACTTCAGCGGCGCGGAGGAGCTGGAGCCGACGCAG
CGGCTGGAGCTGGCGCAGACGTCCGAGGTGCAAGAGGTTCCAGTTCGGCGTGCCCTCTTCGGCAAGGTGACGCGG
CTGGGGTTGCTGGTGGTGGACAACTTTGGCGAGGACGTCTCGCGCCTGACGTACCTGGGCTTTCGCGGCGAGTGG
ACGAGGCTGGGGAGGGCGCCGGAGCAGATTGTCTACGAGGCGGCGCCGCAGCCTGGCGATCATCGGATCAAGGGG
ACGGGGATCAATGAGGTTGGGGGTGGGATTGGAGGGAGGGGCCATGGGTTATGA
Gene >Ophio5|5568
ATGTCTCACTGCCATGATGAGCACCACAGCCACGGTCACGGCCACGACCACTCAGACGACATTACGCCGGCGCTG
CAGTCGTCGCTCTACGAGCAGATTGACTTTGACCAGATCACGACGCTCAACGAAGCGACAAGGGACGCGGGCAAG
GCGGTGGTGAAGAAGACGTGGGCGGAGAGGATGGAGCCGGAACCGGAGCTGGCGAGCGATGCGGACGAGCAGCTG
CTGATGACGGTGCCGTGAGTTTTTTCACAGCCCTTTGTCAGCCCCTAGCGAAGAAATCTAGGCAGAAAAGCACTG
AGGCGACCAAGATTCACGGCACAGGTGAAGCTACACTCGGTCCTCGTCCGAACTTCCCTCTCTGGCGCCGCGCCG
CGCACCCTCCACCTATACGTCAACCAACCGCGGCTCGACTTCAGCGGCGCGGAGGAGCTGGAGCCGACGCAGCGG
CTGGAGCTGGCGCAGACGTCCGAGGTGCAAGAGGTTCCAGTTCGGCGTGCCCTCTTCGGCAAGGTGACGCGGCTG
GGGTTGCTGGTGGTGGACAACTTTGGCGAGGACGTCTCGCGCCTGACGTACCTGGGCTTTCGCGGCGAGTGGACG
AGGCTGGGGAGGGCGCCGGAGCAGATTGTCTACGAGGCGGCGCCGCAGCCTGGCGATCATCGGATCAAGGGGACG
GGGATCAATGAGGTTGGGGGTGGGATTGGAGGGAGGGGCCATGGGTTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail