Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5564
Gene name
Locationscaffold_46:13355..17119
Strand+
Gene length (bp)3764
Transcript length (bp)3303
Coding sequence length (bp)3300
Protein length (aa) 1100

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 4.3E-06 374 451
PF12796 Ank_2 Ankyrin repeats (3 copies) 5.1E-08 461 519
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.0E-11 532 615
PF13637 Ank_4 Ankyrin repeats (many copies) 8.9E-05 396 448
PF13637 Ank_4 Ankyrin repeats (many copies) 4.2E-08 429 482
PF13637 Ank_4 Ankyrin repeats (many copies) 5.5E-06 464 515
PF13637 Ank_4 Ankyrin repeats (many copies) 5.0E-05 545 582
PF13637 Ank_4 Ankyrin repeats (many copies) 1.1E-05 569 614
PF03105 SPX SPX domain 9.4E-09 216 267
PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family 2.7E-07 832 1066

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 104 1100 0.0E+00
sp|P17442|PHO81_YEAST Phosphate system positive regulatory protein PHO81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO81 PE=1 SV=2 396 1062 5.0E-88
sp|P17442|PHO81_YEAST Phosphate system positive regulatory protein PHO81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO81 PE=1 SV=2 104 296 2.0E-36
sp|Q02979|GDE1_YEAST Glycerophosphodiester phosphodiesterase GDE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDE1 PE=1 SV=1 104 882 2.0E-27
sp|Q74ZH9|GDE1_ASHGO Glycerophosphodiester phosphodiesterase GDE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GDE1 PE=3 SV=2 749 1088 4.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 104 1100 0.0E+00
sp|P17442|PHO81_YEAST Phosphate system positive regulatory protein PHO81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO81 PE=1 SV=2 396 1062 5.0E-88
sp|P17442|PHO81_YEAST Phosphate system positive regulatory protein PHO81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO81 PE=1 SV=2 104 296 2.0E-36
sp|Q02979|GDE1_YEAST Glycerophosphodiester phosphodiesterase GDE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDE1 PE=1 SV=1 104 882 2.0E-27
sp|Q74ZH9|GDE1_ASHGO Glycerophosphodiester phosphodiesterase GDE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GDE1 PE=3 SV=2 749 1088 4.0E-23
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 392 632 7.0E-22
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 421 618 1.0E-20
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 366 615 1.0E-20
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 366 615 3.0E-20
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 399 614 4.0E-20
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 421 618 1.0E-19
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 392 614 5.0E-19
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 392 632 1.0E-18
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 399 632 1.0E-18
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 399 632 6.0E-18
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 367 647 2.0E-17
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 366 614 4.0E-17
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 366 614 5.0E-17
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 334 714 5.0E-17
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 399 614 8.0E-17
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 399 614 1.0E-16
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 399 614 1.0E-16
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 358 614 2.0E-16
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 399 614 2.0E-16
sp|Q63618|ESPN_RAT Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 333 666 2.0E-16
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 399 626 3.0E-16
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 415 626 3.0E-16
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 318 618 3.0E-16
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 399 614 4.0E-16
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 366 614 4.0E-16
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 318 618 4.0E-16
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 391 615 5.0E-16
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 333 614 5.0E-16
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 421 618 8.0E-16
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 317 644 9.0E-16
sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 333 621 1.0E-15
sp|Q499M5|ANR16_RAT Ankyrin repeat domain-containing protein 16 OS=Rattus norvegicus GN=Ankrd16 PE=2 SV=1 428 630 1.0E-15
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 317 644 1.0E-15
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 391 614 2.0E-15
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 367 614 2.0E-15
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 429 617 2.0E-15
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 399 632 4.0E-15
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 399 607 4.0E-15
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 367 626 4.0E-15
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 399 614 5.0E-15
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 392 614 5.0E-15
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 367 626 5.0E-15
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 399 585 6.0E-15
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 402 614 6.0E-15
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 425 619 7.0E-15
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 399 614 9.0E-15
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 399 614 1.0E-14
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 358 668 1.0E-14
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 392 614 1.0E-14
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 364 621 1.0E-14
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 429 617 1.0E-14
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 399 618 2.0E-14
sp|Q8N9B4|ANR42_HUMAN Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 329 614 2.0E-14
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 389 614 2.0E-14
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 421 654 2.0E-14
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 386 633 2.0E-14
sp|Q02979|GDE1_YEAST Glycerophosphodiester phosphodiesterase GDE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDE1 PE=1 SV=1 900 1088 3.0E-14
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 399 618 3.0E-14
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 399 585 3.0E-14
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 367 626 3.0E-14
sp|Q8WXE0|CSKI2_HUMAN Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 389 614 3.0E-14
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 399 618 4.0E-14
sp|Q4P6L3|AKR1_USTMA Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 432 614 4.0E-14
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 254 647 4.0E-14
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 399 585 4.0E-14
sp|Q9C104|GDE1_SCHPO Glycerophosphodiester phosphodiesterase gde1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gde1 PE=1 SV=1 815 1089 5.0E-14
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 415 626 6.0E-14
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 399 585 6.0E-14
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 383 614 8.0E-14
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 383 614 8.0E-14
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 399 585 8.0E-14
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 432 609 9.0E-14
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 432 589 9.0E-14
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 384 614 9.0E-14
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 384 614 9.0E-14
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 366 614 9.0E-14
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 378 614 1.0E-13
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 402 645 2.0E-13
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 399 583 2.0E-13
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 384 614 2.0E-13
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 399 585 2.0E-13
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 399 585 2.0E-13
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 277 586 2.0E-13
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 399 585 2.0E-13
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 399 583 2.0E-13
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 399 583 2.0E-13
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 399 585 2.0E-13
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 421 654 3.0E-13
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 399 583 3.0E-13
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 432 589 3.0E-13
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 318 603 4.0E-13
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 386 654 4.0E-13
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 421 654 4.0E-13
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 399 583 4.0E-13
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 394 592 4.0E-13
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 428 614 4.0E-13
sp|Q8VHK1|CSKI2_MOUSE Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 389 614 4.0E-13
sp|A2AS55|ANR16_MOUSE Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 428 614 4.0E-13
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 428 614 5.0E-13
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 277 586 5.0E-13
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 432 589 5.0E-13
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 399 647 5.0E-13
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 399 585 5.0E-13
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 425 614 5.0E-13
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 425 614 5.0E-13
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 399 585 5.0E-13
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 399 585 5.0E-13
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 428 614 6.0E-13
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 318 603 6.0E-13
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 399 623 6.0E-13
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 418 590 6.0E-13
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 399 583 6.0E-13
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 385 585 6.0E-13
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 399 585 7.0E-13
sp|Q2IBD4|CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 432 582 7.0E-13
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 425 622 8.0E-13
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 384 602 8.0E-13
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 392 629 8.0E-13
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 394 595 8.0E-13
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 399 632 8.0E-13
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 432 614 9.0E-13
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 429 614 1.0E-12
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 327 614 1.0E-12
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 432 589 1.0E-12
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 355 626 1.0E-12
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 399 614 1.0E-12
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 399 585 1.0E-12
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 432 582 1.0E-12
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 399 585 1.0E-12
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 398 618 2.0E-12
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 399 614 2.0E-12
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 337 614 2.0E-12
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 432 596 2.0E-12
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 432 595 2.0E-12
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 415 615 2.0E-12
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 399 585 2.0E-12
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 386 633 2.0E-12
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 367 606 2.0E-12
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 432 582 2.0E-12
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 399 583 2.0E-12
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 374 614 2.0E-12
sp|Q65XV2|XB3_ORYSJ E3 ubiquitin-protein ligase XB3 OS=Oryza sativa subsp. japonica GN=XB3 PE=1 SV=1 399 632 2.0E-12
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 399 585 2.0E-12
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 320 618 3.0E-12
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 389 655 3.0E-12
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 399 585 3.0E-12
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 420 639 3.0E-12
sp|Q862Z2|ASB5_RABIT Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 429 617 3.0E-12
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 432 614 3.0E-12
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 391 614 4.0E-12
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 389 614 4.0E-12
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 395 595 4.0E-12
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 430 587 4.0E-12
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 391 614 6.0E-12
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 396 607 6.0E-12
sp|A2X254|SPX2_ORYSI SPX domain-containing protein 2 OS=Oryza sativa subsp. indica GN=SPX2 PE=3 SV=1 104 357 6.0E-12
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 466 614 6.0E-12
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 399 614 7.0E-12
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 399 671 7.0E-12
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 395 595 7.0E-12
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 421 608 7.0E-12
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 399 585 7.0E-12
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 364 614 8.0E-12
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 432 585 8.0E-12
sp|Q17QS6|ASB5_BOVIN Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 429 617 8.0E-12
sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 428 614 9.0E-12
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 398 618 1.0E-11
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 399 614 1.0E-11
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 415 614 1.0E-11
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 364 614 1.0E-11
sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 397 614 1.0E-11
sp|Q3KP44|ANR55_HUMAN Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 425 625 1.0E-11
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 409 639 1.0E-11
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 287 618 1.0E-11
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 355 635 1.0E-11
sp|Q9HLN1|Y196_THEAC Putative ankyrin repeat protein Ta0196 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0196 PE=3 SV=1 362 521 1.0E-11
sp|Q9D1A4|ASB5_MOUSE Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 429 617 1.0E-11
sp|Q6EPQ3|SPXM1_ORYSJ SPX domain-containing membrane protein Os02g45520 OS=Oryza sativa subsp. japonica GN=Os02g0678200 PE=2 SV=1 103 267 1.0E-11
sp|A2X8A7|SPXM1_ORYSI SPX domain-containing membrane protein OsI_08463 OS=Oryza sativa subsp. indica GN=OsI_08463 PE=3 SV=2 103 267 1.0E-11
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 382 618 1.0E-11
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 399 587 2.0E-11
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 447 614 2.0E-11
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 387 671 2.0E-11
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 396 607 2.0E-11
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 358 649 2.0E-11
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 391 614 2.0E-11
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 387 606 2.0E-11
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 386 633 2.0E-11
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 415 617 2.0E-11
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 428 623 2.0E-11
sp|Q91ZT8|ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 430 623 2.0E-11
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 399 585 2.0E-11
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 439 625 2.0E-11
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 415 614 3.0E-11
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 334 610 3.0E-11
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 374 617 3.0E-11
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 429 614 3.0E-11
sp|Q9BGT9|ASB7_MACFA Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 392 595 3.0E-11
sp|Q94CT7|XB31_ORYSJ Probable E3 ubiquitin-protein ligase XBOS31 OS=Oryza sativa subsp. japonica GN=XBOS31 PE=2 SV=1 423 632 3.0E-11
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 399 614 3.0E-11
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 359 550 3.0E-11
sp|Q8LBH4|SPX1_ARATH SPX domain-containing protein 1 OS=Arabidopsis thaliana GN=SPX1 PE=2 SV=2 104 295 3.0E-11
sp|Q8VE42|ANR49_MOUSE Ankyrin repeat domain-containing protein 49 OS=Mus musculus GN=Ankrd49 PE=1 SV=1 432 550 3.0E-11
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 382 618 4.0E-11
sp|Q658H5|SPXM3_ORYSJ SPX domain-containing membrane protein Os06g0129400 OS=Oryza sativa subsp. japonica GN=Os06g0129400 PE=2 SV=1 103 267 4.0E-11
sp|A2Y8U6|SPXM3_ORYSI SPX domain-containing membrane protein OsI_21475 OS=Oryza sativa subsp. indica GN=OsI_21475 PE=3 SV=1 103 267 4.0E-11
sp|Q8WWX0|ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 429 617 4.0E-11
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 359 551 4.0E-11
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 392 620 4.0E-11
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 359 550 4.0E-11
sp|Q8VHS6|ASB15_MOUSE Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 399 639 5.0E-11
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 438 618 5.0E-11
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 359 550 5.0E-11
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 387 671 7.0E-11
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 389 671 7.0E-11
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 359 550 7.0E-11
sp|Q6Z784|SPX2_ORYSJ SPX domain-containing protein 2 OS=Oryza sativa subsp. japonica GN=SPX2 PE=2 SV=1 104 357 7.0E-11
sp|Q9Z2F6|BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 411 614 7.0E-11
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 447 614 8.0E-11
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 452 615 8.0E-11
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 351 614 8.0E-11
sp|Q8WVL7|ANR49_HUMAN Ankyrin repeat domain-containing protein 49 OS=Homo sapiens GN=ANKRD49 PE=1 SV=1 434 550 8.0E-11
sp|Q5JPF3|AN36C_HUMAN Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 399 603 8.0E-11
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 439 617 8.0E-11
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 428 614 8.0E-11
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 397 602 8.0E-11
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 328 632 8.0E-11
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 334 632 9.0E-11
sp|Q91ZU0|ASB7_MOUSE Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 392 595 9.0E-11
sp|Q9H672|ASB7_HUMAN Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 392 595 9.0E-11
sp|Q5RCK5|ASB7_PONAB Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 392 595 9.0E-11
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 421 618 9.0E-11
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 428 614 1.0E-10
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 379 614 1.0E-10
sp|Q8N9B4|ANR42_HUMAN Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 462 614 1.0E-10
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 399 629 1.0E-10
sp|Q93ZQ5|SPXM3_ARATH SPX domain-containing membrane protein At4g22990 OS=Arabidopsis thaliana GN=At4g22990 PE=2 SV=2 103 295 1.0E-10
sp|Q69XJ0|SPX1_ORYSJ SPX domain-containing protein 1 OS=Oryza sativa subsp. japonica GN=SPX1 PE=2 SV=1 104 295 1.0E-10
sp|Q5B0V6|AKR1_EMENI Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 439 629 1.0E-10
sp|B8B4D0|SPX1_ORYSI SPX domain-containing protein 1 OS=Oryza sativa subsp. indica GN=SPX1 PE=3 SV=1 104 295 1.0E-10
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 399 599 1.0E-10
sp|Q0JAW2|SPXM2_ORYSJ SPX domain-containing membrane protein Os04g0573000 OS=Oryza sativa subsp. japonica GN=Os04g0573000 PE=2 SV=2 103 267 1.0E-10
sp|B8AT51|SPXM2_ORYSI SPX domain-containing membrane protein OsI_17046 OS=Oryza sativa subsp. indica GN=OsI_17046 PE=3 SV=1 103 267 1.0E-10
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 335 603 2.0E-10
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 353 581 2.0E-10
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 399 607 2.0E-10
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 379 614 2.0E-10
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 399 607 2.0E-10
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 366 583 2.0E-10
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 399 519 2.0E-10
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 398 612 2.0E-10
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 414 614 2.0E-10
sp|Q5EA33|ANR49_BOVIN Ankyrin repeat domain-containing protein 49 OS=Bos taurus GN=ANKRD49 PE=2 SV=1 434 550 2.0E-10
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 306 519 2.0E-10
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 398 612 2.0E-10
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 360 649 2.0E-10
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 394 614 2.0E-10
sp|Q7Y0F6|SPX5_ORYSJ SPX domain-containing protein 5 OS=Oryza sativa subsp. japonica GN=SPX5 PE=2 SV=1 104 284 2.0E-10
sp|A2XHU0|SPX5_ORYSI SPX domain-containing protein 5 OS=Oryza sativa subsp. indica GN=SPX5 PE=3 SV=1 104 284 2.0E-10
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 376 614 3.0E-10
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 389 671 3.0E-10
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 431 607 3.0E-10
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 334 610 3.0E-10
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 334 610 3.0E-10
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 415 619 3.0E-10
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 429 614 3.0E-10
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 392 614 3.0E-10
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 434 582 3.0E-10
sp|A8DZH4|XPR1_DANRE Xenotropic and polytropic retrovirus receptor 1 homolog OS=Danio rerio GN=xpr1 PE=3 SV=1 104 293 3.0E-10
sp|Q9T050|SPXM2_ARATH SPX domain-containing membrane protein At4g11810 OS=Arabidopsis thaliana GN=At4g11810 PE=3 SV=1 103 295 3.0E-10
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 328 632 3.0E-10
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 335 603 4.0E-10
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 366 614 4.0E-10
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 442 614 4.0E-10
sp|P57044|ILK_CAVPO Integrin-linked protein kinase OS=Cavia porcellus GN=ILK PE=2 SV=1 421 519 4.0E-10
sp|Q99J82|ILK_RAT Integrin-linked protein kinase OS=Rattus norvegicus GN=Ilk PE=2 SV=1 421 519 4.0E-10
sp|O55222|ILK_MOUSE Integrin-linked protein kinase OS=Mus musculus GN=Ilk PE=1 SV=2 421 519 4.0E-10
sp|Q13418|ILK_HUMAN Integrin-linked protein kinase OS=Homo sapiens GN=ILK PE=1 SV=2 421 519 4.0E-10
sp|Q3SWY2|ILK_BOVIN Integrin-linked protein kinase OS=Bos taurus GN=ILK PE=2 SV=1 421 519 4.0E-10
sp|Q5R5V4|ILK_PONAB Integrin-linked protein kinase OS=Pongo abelii GN=ILK PE=2 SV=1 421 519 4.0E-10
sp|A7XZ53|XPR1_MUSPA Xenotropic and polytropic retrovirus receptor 1 homolog OS=Mus pahari GN=Xpr1 PE=1 SV=1 104 294 4.0E-10
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 397 607 4.0E-10
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 334 632 5.0E-10
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 361 611 5.0E-10
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 365 614 5.0E-10
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 322 632 5.0E-10
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 359 550 5.0E-10
sp|Q9QZ71|XPR1_MUSTR Xenotropic and polytropic retrovirus receptor 1 OS=Mus terricolor GN=Xpr1 PE=1 SV=1 104 294 5.0E-10
sp|Q9Z0U0|XPR1_MOUSE Xenotropic and polytropic retrovirus receptor 1 OS=Mus musculus GN=Xpr1 PE=1 SV=1 104 294 5.0E-10
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 394 614 5.0E-10
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 398 612 5.0E-10
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 428 623 5.0E-10
sp|P20749|BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 341 579 5.0E-10
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 352 614 6.0E-10
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 386 595 6.0E-10
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 394 614 6.0E-10
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 327 520 6.0E-10
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 410 581 7.0E-10
sp|Q499M5|ANR16_RAT Ankyrin repeat domain-containing protein 16 OS=Rattus norvegicus GN=Ankrd16 PE=2 SV=1 397 614 7.0E-10
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 399 599 7.0E-10
sp|Q6ZVH7|ESPNL_HUMAN Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 399 614 7.0E-10
sp|Q3SZE4|ASB11_BOVIN Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 429 632 7.0E-10
sp|Q2V4F9|SPXM1_ARATH SPX domain-containing membrane protein At1g63010 OS=Arabidopsis thaliana GN=At1g63010 PE=2 SV=1 103 295 7.0E-10
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 327 519 7.0E-10
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 431 614 8.0E-10
sp|A2AS55|ANR16_MOUSE Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 429 614 8.0E-10
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 320 614 9.0E-10
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 416 665 9.0E-10
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 439 633 9.0E-10
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 358 649 1.0E-09
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 399 614 1.0E-09
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 399 671 1.0E-09
sp|Q8VHS6|ASB15_MOUSE Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 351 626 1.0E-09
sp|Q9R032|XPR1_MUSSP Xenotropic and polytropic retrovirus receptor 1 OS=Mus spretus GN=Xpr1 PE=1 SV=1 104 294 1.0E-09
sp|Q5PP62|SPX3_ARATH SPX domain-containing protein 3 OS=Arabidopsis thaliana GN=SPX3 PE=2 SV=1 104 292 1.0E-09
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 395 614 1.0E-09
sp|Q9R031|XPR1_MUSMC Xenotropic and polytropic retrovirus receptor 1 homolog OS=Mus musculus castaneus GN=Xpr1 PE=2 SV=1 104 294 1.0E-09
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 394 614 1.0E-09
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 359 550 1.0E-09
sp|Q812A3|ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 371 521 1.0E-09
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 384 614 2.0E-09
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 392 634 2.0E-09
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 399 614 2.0E-09
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 362 614 2.0E-09
sp|P20749|BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 404 614 2.0E-09
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 414 618 2.0E-09
sp|Q9NPB8|GPCP1_HUMAN Glycerophosphocholine phosphodiesterase GPCPD1 OS=Homo sapiens GN=GPCPD1 PE=1 SV=2 728 1088 2.0E-09
sp|Q9TU72|XPR1_NEOVI Xenotropic and polytropic retrovirus receptor 1 OS=Neovison vison GN=XPR1 PE=2 SV=1 104 294 2.0E-09
sp|Q9UBH6|XPR1_HUMAN Xenotropic and polytropic retrovirus receptor 1 OS=Homo sapiens GN=XPR1 PE=1 SV=1 104 294 2.0E-09
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 442 614 2.0E-09
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 359 550 2.0E-09
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 436 614 2.0E-09
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 322 623 2.0E-09
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 428 623 2.0E-09
sp|Q86SG2|ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 371 519 2.0E-09
sp|Q8BLD6|ANR55_MOUSE Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 425 629 2.0E-09
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 393 587 2.0E-09
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 321 552 3.0E-09
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 421 614 3.0E-09
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 334 629 3.0E-09
sp|Q5RFS1|ASB11_PONAB Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 425 624 3.0E-09
sp|Q8WXH4|ASB11_HUMAN Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 425 624 3.0E-09
sp|Q9QZ70|XPR1_CRIGR Xenotropic and polytropic retrovirus receptor 1 homolog OS=Cricetulus griseus GN=XPR1 PE=2 SV=1 104 294 3.0E-09
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 399 599 3.0E-09
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 353 581 4.0E-09
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 318 683 4.0E-09
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 415 621 4.0E-09
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 392 534 4.0E-09
sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 333 559 5.0E-09
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 424 519 5.0E-09
sp|Q4I8B6|AKR1_GIBZE Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 439 658 6.0E-09
sp|Q28CY9|XPR1_XENTR Xenotropic and polytropic retrovirus receptor 1 homolog OS=Xenopus tropicalis GN=xpr1 PE=2 SV=1 104 290 6.0E-09
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 374 555 6.0E-09
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 334 629 7.0E-09
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 442 614 7.0E-09
sp|P78810|VTC4_SCHPO Vacuolar transporter chaperone 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vtc4 PE=1 SV=2 104 290 7.0E-09
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 366 649 8.0E-09
sp|A6NHY2|AKD1B_HUMAN Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 421 607 8.0E-09
sp|A6QL64|AN36A_HUMAN Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 399 587 8.0E-09
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 399 595 9.0E-09
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 399 595 9.0E-09
sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 399 595 9.0E-09
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 321 517 1.0E-08
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 421 614 1.0E-08
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 366 649 1.0E-08
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 310 626 1.0E-08
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 402 602 1.0E-08
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 364 614 1.0E-08
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 376 546 1.0E-08
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 328 667 1.0E-08
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 399 615 1.0E-08
sp|Q09701|AKR1_SCHPO Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=akr1 PE=3 SV=1 432 614 1.0E-08
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 399 620 1.0E-08
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 365 591 1.0E-08
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 402 602 1.0E-08
sp|Q94B55|XB31_ARATH Putative E3 ubiquitin-protein ligase XBAT31 OS=Arabidopsis thaliana GN=XBAT31 PE=2 SV=1 421 632 1.0E-08
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 374 555 1.0E-08
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 424 620 1.0E-08
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 439 636 1.0E-08
sp|O48781|SPX2_ARATH SPX domain-containing protein 2 OS=Arabidopsis thaliana GN=SPX2 PE=2 SV=1 104 295 1.0E-08
sp|Q74ZH9|GDE1_ASHGO Glycerophosphodiester phosphodiesterase GDE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GDE1 PE=3 SV=2 425 628 2.0E-08
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 399 581 2.0E-08
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 321 517 2.0E-08
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 423 614 2.0E-08
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 312 614 2.0E-08
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 420 626 2.0E-08
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 387 621 2.0E-08
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 387 621 2.0E-08
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 328 664 2.0E-08
sp|Q9WV06|ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 363 534 2.0E-08
sp|Q6DD44|XPR1_XENLA Xenotropic and polytropic retrovirus receptor 1 homolog OS=Xenopus laevis GN=xpr1 PE=2 SV=1 104 290 2.0E-08
sp|Q8N2N9|AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 399 654 2.0E-08
sp|Q91955|MTPN_CHICK Myotrophin OS=Gallus gallus GN=MTPN PE=3 SV=1 421 486 2.0E-08
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 396 614 2.0E-08
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 399 659 2.0E-08
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 442 614 2.0E-08
sp|Q9TU71|ANKR1_RABIT Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 392 534 2.0E-08
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 409 632 3.0E-08
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 318 649 3.0E-08
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 399 595 3.0E-08
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 435 614 3.0E-08
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 394 617 3.0E-08
sp|Q8BLD6|ANR55_MOUSE Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 422 607 3.0E-08
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 399 614 3.0E-08
sp|Q15327|ANKR1_HUMAN Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 392 534 3.0E-08
sp|Q9GZV1|ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 401 565 3.0E-08
sp|Q5UQV3|YL371_MIMIV Putative ankyrin repeat protein L371 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L371 PE=3 SV=1 402 649 3.0E-08
sp|Q865U8|ANKR1_PIG Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 392 534 3.0E-08
sp|P50086|PSD10_YEAST Probable 26S proteasome regulatory subunit p28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAS6 PE=1 SV=1 423 598 3.0E-08
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 399 639 3.0E-08
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 396 614 3.0E-08
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 366 614 3.0E-08
sp|Q74ZH9|GDE1_ASHGO Glycerophosphodiester phosphodiesterase GDE1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GDE1 PE=3 SV=2 104 295 4.0E-08
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 409 632 4.0E-08
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 455 633 4.0E-08
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 325 614 4.0E-08
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 394 614 4.0E-08
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 394 595 4.0E-08
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 357 631 4.0E-08
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 378 614 4.0E-08
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 385 614 4.0E-08
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 399 626 4.0E-08
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 415 632 4.0E-08
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 366 614 4.0E-08
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 432 614 4.0E-08
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 455 633 5.0E-08
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 415 628 5.0E-08
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 325 614 5.0E-08
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 385 614 5.0E-08
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 464 614 5.0E-08
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 421 614 5.0E-08
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 421 614 5.0E-08
sp|Q9CQ31|ASB11_MOUSE Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 425 585 5.0E-08
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 318 731 6.0E-08
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 392 614 6.0E-08
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 399 521 6.0E-08
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 402 602 6.0E-08
sp|Q7XEY9|SPX3_ORYSJ SPX domain-containing protein 3 OS=Oryza sativa subsp. japonica GN=SPX3 PE=2 SV=1 104 284 6.0E-08
sp|A2Z6W1|SPX3_ORYSI SPX domain-containing protein 3 OS=Oryza sativa subsp. indica GN=SPX3 PE=3 SV=1 104 284 6.0E-08
sp|Q5NVB9|ZDH13_PONAB Palmitoyltransferase ZDHHC13 OS=Pongo abelii GN=ZDHHC13 PE=2 SV=1 415 595 6.0E-08
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 387 632 7.0E-08
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 394 595 7.0E-08
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 353 538 7.0E-08
sp|Q6ZVH7|ESPNL_HUMAN Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 436 618 7.0E-08
sp|Q8IUH4|ZDH13_HUMAN Palmitoyltransferase ZDHHC13 OS=Homo sapiens GN=ZDHHC13 PE=1 SV=3 415 595 7.0E-08
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 374 632 7.0E-08
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 466 632 8.0E-08
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 366 649 8.0E-08
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 321 595 8.0E-08
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 324 555 8.0E-08
sp|Q24145|SHARK_DROME Tyrosine-protein kinase shark OS=Drosophila melanogaster GN=shark PE=2 SV=2 389 517 8.0E-08
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 321 595 9.0E-08
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 327 547 1.0E-07
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 327 671 1.0E-07
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 392 549 1.0E-07
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 423 602 1.0E-07
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 319 611 1.0E-07
sp|Q94B55|XB31_ARATH Putative E3 ubiquitin-protein ligase XBAT31 OS=Arabidopsis thaliana GN=XBAT31 PE=2 SV=1 390 505 1.0E-07
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 396 614 1.0E-07
sp|P58546|MTPN_HUMAN Myotrophin OS=Homo sapiens GN=MTPN PE=1 SV=2 421 486 1.0E-07
sp|Q863Z4|MTPN_CANLF Myotrophin OS=Canis lupus familiaris GN=MTPN PE=3 SV=3 421 486 1.0E-07
sp|Q3T0F7|MTPN_BOVIN Myotrophin OS=Bos taurus GN=MTPN PE=1 SV=3 421 486 1.0E-07
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 416 665 1.0E-07
sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 366 581 1.0E-07
sp|P62775|MTPN_RAT Myotrophin OS=Rattus norvegicus GN=Mtpn PE=1 SV=2 421 486 1.0E-07
sp|P62774|MTPN_MOUSE Myotrophin OS=Mus musculus GN=Mtpn PE=1 SV=2 421 486 1.0E-07
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 465 614 2.0E-07
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 399 638 2.0E-07
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 465 614 2.0E-07
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 465 614 2.0E-07
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 327 671 2.0E-07
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 423 614 2.0E-07
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 461 615 2.0E-07
sp|Q3KP44|ANR55_HUMAN Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 421 607 2.0E-07
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 373 614 2.0E-07
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 439 633 2.0E-07
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 438 633 2.0E-07
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 464 614 2.0E-07
sp|Q28FJ2|ANR37_XENTR Ankyrin repeat domain-containing protein 37 OS=Xenopus tropicalis GN=ankrd37 PE=2 SV=1 400 481 2.0E-07
sp|Q5BKI6|ANKR1_XENTR Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 392 536 2.0E-07
sp|Q9CWU2|ZDH13_MOUSE Palmitoyltransferase ZDHHC13 OS=Mus musculus GN=Zdhhc13 PE=1 SV=2 422 595 2.0E-07
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 432 607 2.0E-07
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 432 607 2.0E-07
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 425 519 2.0E-07
sp|Q8R560|ANKR1_RAT Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 379 534 2.0E-07
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 374 549 2.0E-07
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 367 614 3.0E-07
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 369 614 3.0E-07
sp|P97819|PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 388 621 3.0E-07
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 402 583 3.0E-07
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 395 534 3.0E-07
sp|Q9J5H7|V024_FOWPN Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 410 655 3.0E-07
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 423 664 3.0E-07
sp|P97570|PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 388 621 3.0E-07
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 428 633 3.0E-07
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 374 638 4.0E-07
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 366 614 4.0E-07
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 399 640 4.0E-07
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 394 585 4.0E-07
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 394 585 4.0E-07
sp|Q5UPH0|YL100_MIMIV Putative ankyrin repeat protein L100 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L100 PE=3 SV=1 393 596 4.0E-07
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 378 614 5.0E-07
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 353 538 5.0E-07
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 429 655 5.0E-07
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 428 617 5.0E-07
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 374 549 5.0E-07
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 428 614 5.0E-07
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 399 620 5.0E-07
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 331 521 5.0E-07
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 466 614 6.0E-07
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 416 618 6.0E-07
sp|Q5ZM55|FEM1B_CHICK Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 402 553 6.0E-07
sp|P98150|NFKB2_CHICK Nuclear factor NF-kappa-B p100 subunit OS=Gallus gallus GN=NFKB2 PE=1 SV=1 425 614 6.0E-07
sp|Q4KL97|ANKR1_XENLA Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 392 536 6.0E-07
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 399 620 6.0E-07
sp|Q6S5H5|POTEG_HUMAN POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 399 620 6.0E-07
sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 428 636 6.0E-07
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 401 566 7.0E-07
sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 415 581 7.0E-07
sp|Q8TF21|ANR24_HUMAN Ankyrin repeat domain-containing protein 24 OS=Homo sapiens GN=ANKRD24 PE=2 SV=2 397 552 7.0E-07
sp|Q6ZVZ8|ASB18_HUMAN Ankyrin repeat and SOCS box protein 18 OS=Homo sapiens GN=ASB18 PE=2 SV=2 464 595 7.0E-07
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 432 603 7.0E-07
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 331 614 7.0E-07
sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 396 579 7.0E-07
sp|A6NI47|POTEM_HUMAN Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 399 620 7.0E-07
sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 430 636 7.0E-07
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 488 692 7.0E-07
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 466 632 8.0E-07
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 366 618 8.0E-07
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 394 614 8.0E-07
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 423 625 8.0E-07
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 364 595 8.0E-07
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 348 514 8.0E-07
sp|Q8CGB3|UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 374 579 8.0E-07
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 399 620 8.0E-07
sp|Q7T2B9|MTPN_DANRE Myotrophin OS=Danio rerio GN=mtpn PE=3 SV=1 415 486 8.0E-07
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 396 565 8.0E-07
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 399 614 9.0E-07
sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 349 621 9.0E-07
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 406 549 9.0E-07
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 430 603 1.0E-06
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 466 614 1.0E-06
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 350 620 1.0E-06
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 331 585 1.0E-06
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 419 595 1.0E-06
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 406 549 1.0E-06
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 364 595 1.0E-06
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 387 617 1.0E-06
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 417 587 1.0E-06
sp|Q8CGB3|UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 423 614 1.0E-06
sp|Q9CR42|ANKR1_MOUSE Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 379 534 1.0E-06
sp|Q569N2|ANR37_MOUSE Ankyrin repeat domain-containing protein 37 OS=Mus musculus GN=Ankrd37 PE=2 SV=1 499 615 1.0E-06
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 431 632 1.0E-06
sp|Q9Z205|RFXK_MOUSE DNA-binding protein RFXANK OS=Mus musculus GN=Rfxank PE=2 SV=1 410 517 1.0E-06
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 399 500 1.0E-06
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 428 636 1.0E-06
sp|Q4R690|ZDH13_MACFA Palmitoyltransferase ZDHHC13 OS=Macaca fascicularis GN=ZDHHC13 PE=2 SV=1 415 595 1.0E-06
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 428 636 1.0E-06
sp|Q875S9|AKR1_LACK1 Palmitoyltransferase AKR1 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=AKR1 PE=3 SV=1 332 556 1.0E-06
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 410 617 1.0E-06
sp|Q9UK73|FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 402 560 1.0E-06
sp|P0C6P7|FEM1B_RAT Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 402 560 1.0E-06
sp|Q9Z2G0|FEM1B_MOUSE Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 402 560 1.0E-06
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 387 632 2.0E-06
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 399 519 2.0E-06
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 466 632 2.0E-06
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 333 614 2.0E-06
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 320 614 2.0E-06
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 385 614 2.0E-06
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 443 635 2.0E-06
sp|Q8BLD6|ANR55_MOUSE Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 360 489 2.0E-06
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 394 612 2.0E-06
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 314 614 2.0E-06
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 435 608 2.0E-06
sp|O14593|RFXK_HUMAN DNA-binding protein RFXANK OS=Homo sapiens GN=RFXANK PE=1 SV=2 410 517 2.0E-06
sp|Q9J502|V233_FOWPN Putative ankyrin repeat protein FPV233 OS=Fowlpox virus (strain NVSL) GN=FPV233 PE=3 SV=1 380 566 2.0E-06
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 350 615 2.0E-06
sp|Q5R6D7|ASB8_PONAB Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 467 632 2.0E-06
sp|Q00653|NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens GN=NFKB2 PE=1 SV=4 425 614 2.0E-06
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 455 615 3.0E-06
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 392 614 3.0E-06
sp|Q65XV2|XB3_ORYSJ E3 ubiquitin-protein ligase XB3 OS=Oryza sativa subsp. japonica GN=XB3 PE=1 SV=1 390 502 3.0E-06
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 421 614 3.0E-06
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 376 549 3.0E-06
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 396 565 3.0E-06
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 399 581 3.0E-06
sp|Q52T38|ZDH22_ARATH Protein S-acyltransferase 24 OS=Arabidopsis thaliana GN=PAT24 PE=2 SV=1 396 607 3.0E-06
sp|Q9H765|ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 467 632 3.0E-06
sp|Q05753|AKRP_ARATH Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 403 617 3.0E-06
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 424 519 3.0E-06
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 458 607 3.0E-06
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 458 607 3.0E-06
sp|Q9SAR5|AKR2A_ARATH Ankyrin repeat domain-containing protein 2A OS=Arabidopsis thaliana GN=AKR2A PE=1 SV=2 399 516 3.0E-06
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 465 614 4.0E-06
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 421 636 4.0E-06
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 469 614 4.0E-06
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 432 620 4.0E-06
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 325 563 4.0E-06
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 429 614 4.0E-06
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 396 602 4.0E-06
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 399 581 4.0E-06
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 399 581 4.0E-06
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 511 617 4.0E-06
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 399 581 4.0E-06
sp|Q4R544|ASB8_MACFA Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 467 632 4.0E-06
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 408 581 4.0E-06
sp|Q6GPE5|FEM1B_XENLA Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 342 553 4.0E-06
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 419 587 4.0E-06
sp|Q6KAE5|XB32_ORYSJ Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 436 614 4.0E-06
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 432 619 4.0E-06
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 320 594 5.0E-06
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 350 632 5.0E-06
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 353 538 5.0E-06
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 423 594 5.0E-06
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 432 606 5.0E-06
sp|Q10B79|SPX4_ORYSJ SPX domain-containing protein 4 OS=Oryza sativa subsp. japonica GN=SPX4 PE=2 SV=1 104 324 5.0E-06
sp|A2XNL6|SPX4_ORYSI SPX domain-containing protein 4 OS=Oryza sativa subsp. indica GN=SPX4 PE=3 SV=1 104 324 5.0E-06
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 511 617 5.0E-06
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 440 622 6.0E-06
sp|Q15327|ANKR1_HUMAN Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 401 566 6.0E-06
sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 423 664 6.0E-06
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 415 519 6.0E-06
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 432 594 6.0E-06
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 379 519 6.0E-06
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 511 617 6.0E-06
sp|A2A2Z9|AN18B_HUMAN Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 399 582 6.0E-06
sp|Q96AX9|MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 424 633 6.0E-06
sp|Q6KAE5|XB32_ORYSJ Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 387 605 7.0E-06
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 424 519 7.0E-06
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 432 602 7.0E-06
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 366 614 7.0E-06
sp|P14360|V240_FOWPN Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 430 591 7.0E-06
sp|Q9J5I7|V014_FOWPN Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 393 617 7.0E-06
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 350 614 8.0E-06
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 389 602 8.0E-06
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 373 614 8.0E-06
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 376 563 8.0E-06
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 406 651 8.0E-06
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 350 521 8.0E-06
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 424 519 8.0E-06
sp|B0G124|Y9043_DICDI Ankyrin repeat-containing protein DDB_G0279043 OS=Dictyostelium discoideum GN=DDB_G0279043 PE=3 SV=1 399 519 8.0E-06
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 513 632 9.0E-06
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 402 594 9.0E-06
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 439 624 9.0E-06
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 423 614 9.0E-06
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 439 624 9.0E-06
sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 355 519 9.0E-06
sp|Q9TZM3|LRK1_CAEEL Leucine-rich repeat serine/threonine-protein kinase 1 OS=Caenorhabditis elegans GN=lrk-1 PE=1 SV=6 315 621 1.0E-05
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 420 617 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0008081 phosphoric diester hydrolase activity Yes
GO:0005515 protein binding Yes
GO:0006629 lipid metabolic process Yes
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016788 hydrolase activity, acting on ester bonds No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6774 0.557 0.1284 0.1153 0.1271 0.0569 0.1785 0.2593 0.2315 0.0165

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1067
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3165
Ophiocordyceps australis map64 (Brazil) OphauB2|5126
Ophiocordyceps camponoti-floridani Ophcf2|01561
Ophiocordyceps camponoti-rufipedis Ophun1|6985
Ophiocordyceps kimflemingae Ophio5|5564 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10018

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5564
MRSRARCHALKQSFFLAISAATDKERPSLLLRLEPIAASAAIGFAVPPLCFPETSGRNAIATVNGPPGPPLPCLE
PISGGICRRQHIEQKPSPTLSRAGSRRIMKFGKHIQKRQLEIPEYCASFVNYKALKKLIKKLSATPTLPALNDAH
RPSAAGDSQAALQANKATFFFQLERELDKVNAFYLQKEAELKIRLKTLLDKKKVLQTRPDIPRRSSKFTTLEEGF
QQFATDLNKLQQFVDINGTAFSKILKKWDKTSKSKTKELYLSRAVEVQPFFNAPVISELSDQVTTSLQELGAWSD
GIQVNFSASGHVVPSQHFDEADADTLFFDTVVSGNLESLRDLLARTRPVRDGESSLTDRVTRTFLTAIHDAPRES
LQILLDTGLVDLHSYDDINERNCLHQAAIYGKQHVLEWGLSAAVAVDRTDVYGRAPLHYTSQHGRLEMLEMLLDA
NPRTIDLADHDNFTPLIHAIRHGHIDCVQRLLARSARIDAVPDAGHAPLNLACEHASEPVVELLLRHGAGMLPDA
EGLYPQHLVARSGKSSHLLLLLKQYGADLDQVDRLYGWTPLVHAASEGNVDCLQTLLRIGVDAHVVDEKGLPAMY
YAAWEGHLECMKLLTPFNTRSRTSPLVAQAPLGPMNGSAAPVPMTLDPDGIPELELPPPIIPLRRYGHNFLDTKT
VVQINFEETLGQPLVFFQDGKYPAARLTISSKLSGLIPKNIMLPFQEDTRIVSFQVDNIDTFSLDLDVFPTYGAK
VIARTVALPSVLGPHQGSASSCLPLFDPRLRAIGQISFTTDVIRPFQGQPLEIADFETYWKATSQLDQPTSAVVT
GSSLCGDYVRLLVQHTSDGVPIVWPQWTVPCGGIDMPVCRLSLDQFRAMTGRPEEPVVPSTTTAEEIADMFRGGA
TAGVTLAAALEVLPAGVHVNLQVLYPTAEEEKTLGLGPAVDVNLSVDSILAAVFDHARAQRAQHRPPDVVRSVVF
SSYSARVCAALNWKQPNFPVFLCNDLGREPSLDEGRRDGDARRSMSIKEAVRIAQSNNLMGLMCHGRLLKMVPAL
VDAIKSHGLALVTDKSTDGPSCNSLSHGPKGVDGVLRDHGILRFNDCIDM
Coding >Ophio5|5564
ATGCGAAGTCGCGCGCGCTGCCATGCCCTGAAGCAGTCGTTTTTTCTCGCCATCTCAGCGGCAACGGATAAGGAG
AGACCATCTCTGCTCCTCCGACTCGAACCAATCGCTGCTTCCGCGGCAATTGGATTCGCAGTCCCACCTCTCTGC
TTCCCCGAGACAAGCGGGCGTAACGCGATTGCAACGGTCAATGGGCCCCCCGGTCCACCGTTGCCATGTCTTGAA
CCCATCTCCGGGGGCATTTGCAGACGTCAACACATCGAGCAGAAGCCATCACCGACCCTGTCTCGGGCCGGTAGC
CGCCGCATCATGAAGTTCGGCAAGCATATCCAGAAGCGCCAGCTCGAGATCCCCGAGTACTGCGCCAGCTTCGTC
AACTACAAGGCCCTCAAAAAGCTCATCAAGAAGCTGTCCGCTACGCCGACGCTGCCCGCTCTGAACGATGCCCAT
CGTCCGTCGGCAGCCGGTGACTCGCAGGCTGCCCTGCAGGCTAACAAGGCTACCTTCTTCTTTCAACTGGAGCGA
GAGCTCGACAAGGTGAACGCCTTTTACTTGCAAAAGGAAGCCGAGCTCAAGATCCGGCTCAAGACGCTGCTTGAC
AAGAAAAAGGTGCTGCAGACGCGGCCCGACATCCCTCGGCGCTCGTCCAAGTTCACAACGCTTGAGGAAGGCTTC
CAGCAGTTTGCCACAGACCTCAACAAGCTGCAGCAGTTTGTCGATATCAACGGCACCGCCTTTTCCAAGATTCTC
AAGAAATGGGACAAGACGTCCAAGTCCAAGACCAAGGAGCTCTATCTGTCCCGCGCCGTCGAGGTCCAACCCTTC
TTCAACGCCCCCGTTATCAGCGAGCTGTCCGACCAGGTCACGACCAGCCTGCAGGAGCTGGGCGCCTGGTCGGAC
GGAATCCAGGTCAACTTTAGCGCCTCGGGCCACGTCGTTCCGAGCCAGCACTTTGACGAGGCCGATGCCGACACG
CTGTTCTTCGATACCGTCGTGTCCGGGAACCTCGAGTCGCTGCGCGATCTCCTCGCCAGGACGCGGCCAGTCCGC
GATGGCGAGAGCTCCTTGACGGATCGCGTTACCCGGACCTTTCTAACGGCCATCCATGATGCGCCGCGCGAGTCG
CTGCAGATACTGCTCGACACCGGTCTCGTCGACCTGCATTCGTACGACGACATCAACGAGCGCAACTGTCTGCAC
CAGGCCGCCATCTACGGCAAGCAGCACGTCCTGGAATGGGGCCTGAGTGCCGCCGTCGCCGTCGACCGGACCGAC
GTCTACGGCCGGGCGCCGTTGCACTACACCAGCCAGCACGGCCGGCTGGAGATGCTGGAGATGCTACTGGACGCG
AACCCCCGGACCATTGACCTGGCCGATCACGATAACTTCACCCCGTTGATCCACGCCATCCGACATGGGCATATC
GACTGCGTCCAGAGGCTCCTGGCCAGATCGGCGCGCATCGATGCCGTGCCGGACGCGGGCCACGCGCCCCTCAAC
CTGGCCTGCGAGCACGCGTCGGAGCCGGTGGTGGAGCTCCTGCTGCGGCACGGCGCGGGGATGCTCCCGGACGCC
GAGGGCCTATATCCGCAGCATCTGGTGGCGCGGTCTGGCAAGTCCTCACACCTTCTGCTGCTGCTCAAGCAGTAC
GGCGCGGACCTGGACCAGGTCGACAGGCTCTACGGCTGGACGCCGCTCGTGCACGCGGCAAGCGAGGGCAACGTC
GATTGCCTGCAGACTCTGCTGCGGATAGGCGTCGACGCTCATGTCGTGGACGAAAAGGGCCTGCCTGCCATGTAC
TATGCGGCCTGGGAGGGCCACCTTGAATGCATGAAGCTGCTTACGCCCTTCAATACGCGAAGCAGGACCAGTCCG
CTCGTCGCACAGGCGCCCCTGGGCCCTATGAACGGCAGTGCGGCTCCCGTGCCCATGACGCTGGATCCCGATGGG
ATCCCCGAGCTCGAGCTGCCGCCGCCCATCATCCCGCTTCGACGATACGGCCACAACTTTCTCGACACCAAGACG
GTGGTGCAGATCAACTTTGAGGAGACGTTGGGACAGCCTCTCGTTTTCTTCCAGGACGGCAAGTATCCGGCAGCT
CGGCTCACCATTTCGTCGAAGCTGTCGGGCCTCATCCCCAAGAACATCATGCTCCCCTTTCAGGAAGACACGCGC
ATCGTCTCCTTCCAGGTCGACAACATCGACACCTTCTCCCTCGACCTGGACGTCTTCCCGACGTATGGAGCAAAG
GTCATCGCCAGGACGGTGGCGCTGCCGAGTGTGCTGGGGCCGCACCAGGGCAGCGCAAGCAGCTGCCTGCCCCTG
TTCGATCCGCGGCTGCGAGCCATCGGGCAGATCAGCTTCACGACGGACGTGATCCGGCCATTCCAGGGACAGCCG
CTCGAGATTGCCGATTTTGAGACGTACTGGAAGGCGACGAGCCAGCTCGACCAGCCGACGAGCGCCGTGGTGACC
GGGTCCAGCCTCTGCGGGGACTACGTGCGGCTGTTGGTGCAACACACGAGCGATGGAGTGCCGATCGTGTGGCCC
CAATGGACGGTGCCGTGCGGCGGCATCGACATGCCCGTGTGCCGGCTATCGCTGGACCAGTTCCGGGCCATGACC
GGACGGCCCGAGGAGCCGGTGGTGCCGTCGACGACGACAGCCGAGGAGATCGCCGACATGTTCCGGGGCGGGGCC
ACGGCGGGCGTGACGCTGGCCGCGGCGCTCGAGGTGCTGCCGGCGGGGGTACACGTCAACCTGCAGGTCCTATAC
CCGACGGCCGAGGAGGAGAAGACGCTGGGGCTCGGCCCGGCGGTCGACGTCAACCTGTCAGTCGACTCGATCCTC
GCCGCCGTCTTCGACCACGCGCGGGCGCAGAGGGCGCAGCACCGGCCTCCCGACGTGGTGCGGTCGGTGGTGTTT
AGTAGCTACAGTGCGCGTGTGTGCGCGGCCCTCAACTGGAAGCAGCCCAACTTTCCCGTCTTCCTGTGCAACGAC
CTGGGACGAGAGCCGAGCCTGGACGAGGGGCGGCGCGACGGCGACGCGAGGAGGAGCATGTCGATTAAGGAGGCG
GTGCGGATCGCGCAGAGCAACAACCTGATGGGGCTCATGTGCCACGGACGCCTTCTAAAGATGGTGCCGGCACTC
GTGGATGCCATCAAGTCGCACGGGCTTGCTCTCGTCACGGACAAGTCGACGGACGGCCCGTCATGCAATTCTCTC
TCACACGGGCCCAAGGGTGTGGACGGCGTACTGCGAGACCACGGCATCTTGCGGTTCAATGACTGCATTGATATG
Transcript >Ophio5|5564
ATGCGAAGTCGCGCGCGCTGCCATGCCCTGAAGCAGTCGTTTTTTCTCGCCATCTCAGCGGCAACGGATAAGGAG
AGACCATCTCTGCTCCTCCGACTCGAACCAATCGCTGCTTCCGCGGCAATTGGATTCGCAGTCCCACCTCTCTGC
TTCCCCGAGACAAGCGGGCGTAACGCGATTGCAACGGTCAATGGGCCCCCCGGTCCACCGTTGCCATGTCTTGAA
CCCATCTCCGGGGGCATTTGCAGACGTCAACACATCGAGCAGAAGCCATCACCGACCCTGTCTCGGGCCGGTAGC
CGCCGCATCATGAAGTTCGGCAAGCATATCCAGAAGCGCCAGCTCGAGATCCCCGAGTACTGCGCCAGCTTCGTC
AACTACAAGGCCCTCAAAAAGCTCATCAAGAAGCTGTCCGCTACGCCGACGCTGCCCGCTCTGAACGATGCCCAT
CGTCCGTCGGCAGCCGGTGACTCGCAGGCTGCCCTGCAGGCTAACAAGGCTACCTTCTTCTTTCAACTGGAGCGA
GAGCTCGACAAGGTGAACGCCTTTTACTTGCAAAAGGAAGCCGAGCTCAAGATCCGGCTCAAGACGCTGCTTGAC
AAGAAAAAGGTGCTGCAGACGCGGCCCGACATCCCTCGGCGCTCGTCCAAGTTCACAACGCTTGAGGAAGGCTTC
CAGCAGTTTGCCACAGACCTCAACAAGCTGCAGCAGTTTGTCGATATCAACGGCACCGCCTTTTCCAAGATTCTC
AAGAAATGGGACAAGACGTCCAAGTCCAAGACCAAGGAGCTCTATCTGTCCCGCGCCGTCGAGGTCCAACCCTTC
TTCAACGCCCCCGTTATCAGCGAGCTGTCCGACCAGGTCACGACCAGCCTGCAGGAGCTGGGCGCCTGGTCGGAC
GGAATCCAGGTCAACTTTAGCGCCTCGGGCCACGTCGTTCCGAGCCAGCACTTTGACGAGGCCGATGCCGACACG
CTGTTCTTCGATACCGTCGTGTCCGGGAACCTCGAGTCGCTGCGCGATCTCCTCGCCAGGACGCGGCCAGTCCGC
GATGGCGAGAGCTCCTTGACGGATCGCGTTACCCGGACCTTTCTAACGGCCATCCATGATGCGCCGCGCGAGTCG
CTGCAGATACTGCTCGACACCGGTCTCGTCGACCTGCATTCGTACGACGACATCAACGAGCGCAACTGTCTGCAC
CAGGCCGCCATCTACGGCAAGCAGCACGTCCTGGAATGGGGCCTGAGTGCCGCCGTCGCCGTCGACCGGACCGAC
GTCTACGGCCGGGCGCCGTTGCACTACACCAGCCAGCACGGCCGGCTGGAGATGCTGGAGATGCTACTGGACGCG
AACCCCCGGACCATTGACCTGGCCGATCACGATAACTTCACCCCGTTGATCCACGCCATCCGACATGGGCATATC
GACTGCGTCCAGAGGCTCCTGGCCAGATCGGCGCGCATCGATGCCGTGCCGGACGCGGGCCACGCGCCCCTCAAC
CTGGCCTGCGAGCACGCGTCGGAGCCGGTGGTGGAGCTCCTGCTGCGGCACGGCGCGGGGATGCTCCCGGACGCC
GAGGGCCTATATCCGCAGCATCTGGTGGCGCGGTCTGGCAAGTCCTCACACCTTCTGCTGCTGCTCAAGCAGTAC
GGCGCGGACCTGGACCAGGTCGACAGGCTCTACGGCTGGACGCCGCTCGTGCACGCGGCAAGCGAGGGCAACGTC
GATTGCCTGCAGACTCTGCTGCGGATAGGCGTCGACGCTCATGTCGTGGACGAAAAGGGCCTGCCTGCCATGTAC
TATGCGGCCTGGGAGGGCCACCTTGAATGCATGAAGCTGCTTACGCCCTTCAATACGCGAAGCAGGACCAGTCCG
CTCGTCGCACAGGCGCCCCTGGGCCCTATGAACGGCAGTGCGGCTCCCGTGCCCATGACGCTGGATCCCGATGGG
ATCCCCGAGCTCGAGCTGCCGCCGCCCATCATCCCGCTTCGACGATACGGCCACAACTTTCTCGACACCAAGACG
GTGGTGCAGATCAACTTTGAGGAGACGTTGGGACAGCCTCTCGTTTTCTTCCAGGACGGCAAGTATCCGGCAGCT
CGGCTCACCATTTCGTCGAAGCTGTCGGGCCTCATCCCCAAGAACATCATGCTCCCCTTTCAGGAAGACACGCGC
ATCGTCTCCTTCCAGGTCGACAACATCGACACCTTCTCCCTCGACCTGGACGTCTTCCCGACGTATGGAGCAAAG
GTCATCGCCAGGACGGTGGCGCTGCCGAGTGTGCTGGGGCCGCACCAGGGCAGCGCAAGCAGCTGCCTGCCCCTG
TTCGATCCGCGGCTGCGAGCCATCGGGCAGATCAGCTTCACGACGGACGTGATCCGGCCATTCCAGGGACAGCCG
CTCGAGATTGCCGATTTTGAGACGTACTGGAAGGCGACGAGCCAGCTCGACCAGCCGACGAGCGCCGTGGTGACC
GGGTCCAGCCTCTGCGGGGACTACGTGCGGCTGTTGGTGCAACACACGAGCGATGGAGTGCCGATCGTGTGGCCC
CAATGGACGGTGCCGTGCGGCGGCATCGACATGCCCGTGTGCCGGCTATCGCTGGACCAGTTCCGGGCCATGACC
GGACGGCCCGAGGAGCCGGTGGTGCCGTCGACGACGACAGCCGAGGAGATCGCCGACATGTTCCGGGGCGGGGCC
ACGGCGGGCGTGACGCTGGCCGCGGCGCTCGAGGTGCTGCCGGCGGGGGTACACGTCAACCTGCAGGTCCTATAC
CCGACGGCCGAGGAGGAGAAGACGCTGGGGCTCGGCCCGGCGGTCGACGTCAACCTGTCAGTCGACTCGATCCTC
GCCGCCGTCTTCGACCACGCGCGGGCGCAGAGGGCGCAGCACCGGCCTCCCGACGTGGTGCGGTCGGTGGTGTTT
AGTAGCTACAGTGCGCGTGTGTGCGCGGCCCTCAACTGGAAGCAGCCCAACTTTCCCGTCTTCCTGTGCAACGAC
CTGGGACGAGAGCCGAGCCTGGACGAGGGGCGGCGCGACGGCGACGCGAGGAGGAGCATGTCGATTAAGGAGGCG
GTGCGGATCGCGCAGAGCAACAACCTGATGGGGCTCATGTGCCACGGACGCCTTCTAAAGATGGTGCCGGCACTC
GTGGATGCCATCAAGTCGCACGGGCTTGCTCTCGTCACGGACAAGTCGACGGACGGCCCGTCATGCAATTCTCTC
TCACACGGGCCCAAGGGTGTGGACGGCGTACTGCGAGACCACGGCATCTTGCGGTTCAATGACTGCATTGATATG
TAG
Gene >Ophio5|5564
ATGCGAAGTCGCGCGCGCTGCCATGCCCTGAAGCAGTCGTTTTTTCTCGCCATCTCAGCGGCAACGGATAAGGAG
AGAGTGAGAGAGAGAGGATAGAAGAACCTCGGCGAAGCAAAAGTCTGCGACCCAACCTCCTCCAAGCCATCTCTG
CTCCTCCGACTCGAACCAATCGCTGCTTCCGCGGCAATTGGATTCGCAGTCCCACCTCTCTGCTTCCCCGAGACA
AGCGGGCGTAACGCGATTGCAACGGTCAATGGGCCCCCCGGTCCACCGTTGCCATGTCTTGAACCCATCTCCGGG
GGCATTTGCAGACGTCAACACATCGAGCAGAAGCCATCACCGACCCTGTCTCGGGCCGGTAGCCGCCGCATCATG
CAAGTTGTACCGTTGCTTCGGCCCTCAAGCCTCAGCTTGCTGATCAGGCCCCCCCCCCCCCCCCATGACAGGAAG
TTCGGCAAGCATATCCAGAAGCGCCAGCTCGAGATCCCCGAGTACTGCGCCAGCTTCGTCAACTACAAGGCCCTC
AAAAAGGTACTTATTGCCCTTTCCGAAGCTCTTTCAGGAGCCAATCATGGACGCTGATGCCGCTCCGTTGTACCG
TATGGGTAGCTCATCAAGAAGCTGTCCGCTACGCCGACGCTGCCCGCTCTGAACGATGCCCATCGTCCGTCGGCA
GCCGGTGACTCGCAGGCTGCCCTGCAGGCTAACAAGGCTACCTTCTTCTTTCAACTGGTCAGTTGCCGTTGAGAC
GCCGCTGACGTGGCTGTTGCTGAAGCAATTTCGGTTGCAGGAGCGAGAGCTCGACAAGGTGAACGCCTTTTACTT
GCAAAAGGAAGCCGAGGTTTGTCTCGTCCCTCTGTCGTCCCATCCCGTCCCGTCCCGTCTCGGCGAGGGTCCGCG
CCAACTCGGAATAGCTCAAGATCCGGCTCAAGACGCTGCTTGACAAGAAAAAGGTGCTGCAGACGCGGCCCGACA
TCCCTCGGCGCTCGTCCAAGTTCACAACGCTTGAGGAAGGCTTCCAGCAGTTTGCCACAGACCTCAACAAGCTGC
AGCAGTTTGTCGATATCAACGGCACCGCCTTTTCCAAGATTCTCAAGAAATGGGACAAGACGTCCAAGTCCAAGA
CCAAGGAGCTCTATCTGTCCCGCGCCGTCGAGGTCCAACCCTTCTTCAACGCCCCCGTTATCAGCGAGCTGTCCG
ACCAGGTCACGACCAGCCTGCAGGAGCTGGGCGCCTGGTCGGACGGAATCCAGGTCAACTTTAGCGCCTCGGGCC
ACGTCGTTCCGAGCCAGCACTTTGACGAGGCCGATGCCGACACGCTGTTCTTCGATACCGTCGTGTCCGGGAACC
TCGAGTCGCTGCGCGATCTCCTCGCCAGGACGCGGCCAGTCCGCGATGGCGAGAGCTCCTTGACGGATCGCGTTA
CCCGGACCTTTCTAACGGCCATCCATGATGCGCCGCGCGAGTCGCTGCAGATACTGCTCGACACCGGTCTCGTCG
ACCTGCATTCGTACGACGACATCAACGAGCGCAACTGTCTGCACCAGGCCGCCATCTACGGCAAGCAGCACGTCC
TGGAATGGGGCCTGAGTGCCGCCGTCGCCGTCGACCGGACCGACGTCTACGGCCGGGCGCCGTTGCACTACACCA
GCCAGCACGGCCGGCTGGAGATGCTGGAGATGCTACTGGACGGTGAGTCGTTCTCGCGGCCAGTTCGCGCAGAGT
CTGGCCGGCTGATAGGCATCGCAGCGAACCCCCGGACCATTGACCTGGCCGATCACGATAACTTCACCCCGTTGA
TCCACGCCATCCGACATGGGCATATCGACTGCGTCCAGAGGCTCCTGGCCAGATCGGCGCGCATCGATGCCGTGC
CGGACGCGGGCCACGCGCCCCTCAACCTGGCCTGCGAGCACGCGTCGGAGCCGGTGGTGGAGCTCCTGCTGCGGC
ACGGCGCGGGGATGCTCCCGGACGCCGAGGGCCTATATCCGCAGCATCTGGTGGCGCGGTCTGGCAAGTCCTCAC
ACCTTCTGCTGCTGCTCAAGCAGTACGGCGCGGACCTGGACCAGGTCGACAGGCTCTACGGCTGGACGCCGCTCG
TGCACGCGGCAAGCGAGGGCAACGTCGATTGCCTGCAGACTCTGCTGCGGATAGGCGTCGACGCTCATGTCGTGG
ACGAAAAGGGCCTGCCTGCCATGTACTATGCGGCCTGGGAGGGCCACCTTGAATGCATGAAGCTGCTTACGCCCT
TCAATACGCGAAGCAGGACCAGTCCGCTCGTCGCACAGGCGCCCCTGGGCCCTATGAACGGCAGTGCGGCTCCCG
TGCCCATGACGCTGGATCCCGATGGGATCCCCGAGCTCGAGCTGCCGCCGCCCATCATCCCGCTTCGACGATACG
GCCACAACTTTCTCGACACCAAGACGGTGGTGCAGATCAACTTTGAGGAGACGTTGGGACAGCCTCTCGTTTTCT
TCCAGGACGGCAAGTATCCGGCAGCTCGGCTCACCATTTCGTCGAAGCTGTCGGGCCTCATCCCCAAGAACATCA
TGCTCCCCTTTCAGGAAGACACGCGCATCGTCTCCTTCCAGGTCGACAACATCGACACCTTCTCCCTCGACCTGG
ACGTCTTCCCGACGTATGGAGCAAAGGTCATCGCCAGGACGGTGGCGCTGCCGAGTGTGCTGGGGCCGCACCAGG
GCAGCGCAAGCAGCTGCCTGCCCCTGTTCGATCCGCGGCTGCGAGCCATCGGGCAGATCAGCTTCACGACGGACG
TGATCCGGCCATTCCAGGGACAGCCGCTCGAGATTGCCGATTTTGAGACGTACTGGAAGGCGACGAGCCAGCTCG
ACCAGCCGACGAGCGCCGTGGTGACCGGGTCCAGCCTCTGCGGGGACTACGTGCGGCTGTTGGTGCAACACACGA
GCGATGGAGTGCCGATCGTGTGGCCCCAATGGACGGTGCCGTGCGGCGGCATCGACATGCCCGTGTGCCGGCTAT
CGCTGGACCAGTTCCGGGCCATGACCGGACGGCCCGAGGAGCCGGTGGTGCCGTCGACGACGACAGCCGAGGAGA
TCGCCGACATGTTCCGGGGCGGGGCCACGGCGGGCGTGACGCTGGCCGCGGCGCTCGAGGTGCTGCCGGCGGGGG
TACACGTCAACCTGCAGGTCCTATACCCGACGGCCGAGGAGGAGAAGACGCTGGGGCTCGGCCCGGCGGTCGACG
TCAACCTGTCAGTCGACTCGATCCTCGCCGCCGTCTTCGACCACGCGCGGGCGCAGAGGGCGCAGCACCGGCCTC
CCGACGTGGTGCGGTCGGTGGTGTTTAGTAGCTACAGTGCGCGTGTGTGCGCGGCCCTCAACTGGAAGCAGCCCA
ACTTTCCCGTCTTCCTGTGCAACGACCTGGGACGAGAGCCGAGCCTGGACGAGGGGCGGCGCGACGGCGACGCGA
GGAGGAGCATGTCGATTAAGGAGGCGGTGCGGATCGCGCAGAGCAACAACCTGATGGGGCTCATGTGCCACGGAC
GCCTTCTAGTATGATGCCCCCCTTTGGTCCCCTGTCTGACACGGTCCGGCGGCTGACGATTGTGGTAGAAGATGG
TGCCGGCACTCGTGGATGCCATCAAGTCGCACGGGCTTGCTCTCGTCACGGACAAGTCGACGGACGGCCCGTCAT
GCAATTCTCTCTCACACGGGCCCAAGGGTGTGGACGGCGTACTGCGAGACCACGGCATCTTGCGGTTCAATGACT
GCATTGATATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail