Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5559
Gene name
Locationscaffold_46:69..2708
Strand-
Gene length (bp)2639
Transcript length (bp)1485
Coding sequence length (bp)1482
Protein length (aa) 494

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13695|YEN1_SCHPO Uncharacterized serine-rich protein C11G7.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11G7.01 PE=4 SV=1 265 363 3.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 265 287 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 435.20 186.61 683.80
CcL In ants, during behavior modification 286.55 106.54 466.56
CcD In ants, recently dead 253.91 120.71 387.11

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.153675 no
SC16a CcD 0.037242 yes
CcL CcD 0.709391 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5559
MVTSAKILWLQQSLRQIRNDFHIFLVHRPSLSTTVSHRLSQPSISIPHPSFLFAPRPSADERYAVRSRFFLLVPA
VSFDVCLTGQEAFSSCLVEHVGPDEPGADDIGGREPLDRGDGRPADDQQPLPASLPSTSAAPPPASSSPSSSSSS
TEQRPASVPSSSSSPPQRAVSTPSSVPPQSSAPPAAAPSSSSSSQQPDVSSAVVTVTPSNVATSVQVVTSTTTRA
PVGGPSTTSSAASSSTSSAAAELDSSNSASGGGLNQASKVAIGVVVPIAAIAFLAIVGLFWWKKRRARQEAEEER
RKEVEDYSYNPNADPTMPAVGHSVEHAYEMKDEGGYRGWGSTATTTGSRGRKASTTMSGGAAGTYSDPASPIRAN
LSEARSGEPLVDGSSTHEGEILGAMGPSAANNRGGDVRRGPSNASSSYSAAARSDGSDGAMYGNGAAYYEQYGQN
PYSEQRPQEAGSQAVIRDNPARRNTRIENSAHYPQQSAGIAQNF
Coding >Ophio5|5559
ATGGTGACCTCGGCAAAGATTCTGTGGCTTCAGCAGAGCCTCCGGCAAATACGCAACGATTTTCATATTTTTCTC
GTCCACCGCCCGTCACTCTCGACGACTGTTTCTCATAGACTCAGCCAGCCATCCATTTCCATTCCTCACCCTTCA
TTCCTCTTCGCGCCCCGCCCGTCGGCGGACGAGCGATACGCCGTTCGGTCACGTTTCTTTCTTCTTGTTCCGGCC
GTCTCGTTCGACGTCTGCTTGACAGGACAAGAGGCCTTCTCGTCTTGCCTCGTTGAACATGTCGGGCCGGACGAG
CCAGGCGCCGACGACATCGGCGGCCGAGAGCCCCTCGACCGCGGCGACGGCCGCCCAGCCGACGACCAGCAGCCG
CTGCCCGCCAGTCTCCCCAGCACGTCGGCCGCTCCTCCACCCGCCAGCTCCTCGCCGTCGTCCAGCTCCTCGTCC
ACGGAGCAGCGTCCGGCTTCGGTGCCATCGTCTAGCTCCTCGCCGCCCCAACGTGCCGTGTCGACGCCGAGCTCA
GTGCCGCCACAGTCTTCAGCACCTCCCGCCGCCGCCCCTTCCTCCTCGTCCTCCTCGCAGCAGCCCGACGTCTCT
TCGGCCGTCGTCACCGTCACTCCGAGCAATGTGGCCACTAGCGTCCAGGTGGTGACATCGACGACGACCCGGGCG
CCCGTAGGAGGCCCGTCGACGACATCGTCGGCCGCTTCATCGTCGACGTCGTCGGCCGCCGCCGAACTCGACTCG
TCCAACTCGGCCTCTGGTGGCGGCCTGAACCAGGCGTCCAAGGTGGCCATCGGTGTTGTGGTGCCCATCGCCGCC
ATCGCCTTCCTGGCCATCGTCGGTCTCTTTTGGTGGAAGAAGCGGAGGGCGCGTCAGGAAGCCGAAGAGGAGCGC
CGGAAGGAGGTGGAGGACTACTCATACAACCCCAACGCCGACCCCACGATGCCTGCTGTCGGCCACTCGGTCGAG
CACGCGTACGAGATGAAAGACGAGGGCGGCTACCGCGGCTGGGGCTCCACCGCCACCACGACGGGCTCCAGAGGA
CGCAAGGCCTCGACGACAATGTCGGGAGGCGCCGCCGGCACCTACTCGGACCCGGCGTCGCCCATCCGCGCCAAC
CTATCCGAGGCGCGGTCCGGCGAGCCGCTCGTGGACGGCTCGTCGACGCACGAGGGCGAGATCCTCGGCGCCATG
GGGCCGTCGGCGGCCAACAACCGCGGTGGCGACGTGCGTCGAGGGCCGTCCAACGCCTCGTCTTCCTACAGCGCG
GCCGCCCGGTCTGATGGGTCCGACGGCGCCATGTACGGCAACGGCGCGGCCTATTACGAACAGTACGGCCAGAAC
CCGTACAGCGAGCAGAGGCCGCAGGAGGCGGGCAGCCAAGCCGTCATACGCGACAATCCGGCGAGACGCAATACC
CGGATCGAGAACTCGGCGCATTATCCGCAGCAGAGTGCGGGCATTGCTCAAAACTTT
Transcript >Ophio5|5559
ATGGTGACCTCGGCAAAGATTCTGTGGCTTCAGCAGAGCCTCCGGCAAATACGCAACGATTTTCATATTTTTCTC
GTCCACCGCCCGTCACTCTCGACGACTGTTTCTCATAGACTCAGCCAGCCATCCATTTCCATTCCTCACCCTTCA
TTCCTCTTCGCGCCCCGCCCGTCGGCGGACGAGCGATACGCCGTTCGGTCACGTTTCTTTCTTCTTGTTCCGGCC
GTCTCGTTCGACGTCTGCTTGACAGGACAAGAGGCCTTCTCGTCTTGCCTCGTTGAACATGTCGGGCCGGACGAG
CCAGGCGCCGACGACATCGGCGGCCGAGAGCCCCTCGACCGCGGCGACGGCCGCCCAGCCGACGACCAGCAGCCG
CTGCCCGCCAGTCTCCCCAGCACGTCGGCCGCTCCTCCACCCGCCAGCTCCTCGCCGTCGTCCAGCTCCTCGTCC
ACGGAGCAGCGTCCGGCTTCGGTGCCATCGTCTAGCTCCTCGCCGCCCCAACGTGCCGTGTCGACGCCGAGCTCA
GTGCCGCCACAGTCTTCAGCACCTCCCGCCGCCGCCCCTTCCTCCTCGTCCTCCTCGCAGCAGCCCGACGTCTCT
TCGGCCGTCGTCACCGTCACTCCGAGCAATGTGGCCACTAGCGTCCAGGTGGTGACATCGACGACGACCCGGGCG
CCCGTAGGAGGCCCGTCGACGACATCGTCGGCCGCTTCATCGTCGACGTCGTCGGCCGCCGCCGAACTCGACTCG
TCCAACTCGGCCTCTGGTGGCGGCCTGAACCAGGCGTCCAAGGTGGCCATCGGTGTTGTGGTGCCCATCGCCGCC
ATCGCCTTCCTGGCCATCGTCGGTCTCTTTTGGTGGAAGAAGCGGAGGGCGCGTCAGGAAGCCGAAGAGGAGCGC
CGGAAGGAGGTGGAGGACTACTCATACAACCCCAACGCCGACCCCACGATGCCTGCTGTCGGCCACTCGGTCGAG
CACGCGTACGAGATGAAAGACGAGGGCGGCTACCGCGGCTGGGGCTCCACCGCCACCACGACGGGCTCCAGAGGA
CGCAAGGCCTCGACGACAATGTCGGGAGGCGCCGCCGGCACCTACTCGGACCCGGCGTCGCCCATCCGCGCCAAC
CTATCCGAGGCGCGGTCCGGCGAGCCGCTCGTGGACGGCTCGTCGACGCACGAGGGCGAGATCCTCGGCGCCATG
GGGCCGTCGGCGGCCAACAACCGCGGTGGCGACGTGCGTCGAGGGCCGTCCAACGCCTCGTCTTCCTACAGCGCG
GCCGCCCGGTCTGATGGGTCCGACGGCGCCATGTACGGCAACGGCGCGGCCTATTACGAACAGTACGGCCAGAAC
CCGTACAGCGAGCAGAGGCCGCAGGAGGCGGGCAGCCAAGCCGTCATACGCGACAATCCGGCGAGACGCAATACC
CGGATCGAGAACTCGGCGCATTATCCGCAGCAGAGTGCGGGCATTGCTCAAAACTTTTGA
Gene >Ophio5|5559
ATGGTGACCTCGGCAAGTATGTAGGTACCGGCATCAGCTTCGGGGTTCAGGGCCTCTGCTAACGGCAGCAAGTAC
CTCATGGCGCGCCGATACCTGCGTGGTGGCCCAGAGCTTTGCGGAGAAGAGGCCTCCATGTGACCGGTTCCGATA
CCTCGTACGAGAGGGGAACGCTACCGCCCTACCGCCGTCCCCGGACGGGCTGGAGGTTGCACGCTACTTGCTGCC
TACCTAGGCAGGACCTGACCGAGTTAGGCAGGCCGGACCTTGGCGCAGATACGAATATCCGTTCTTTCGCGCCCT
CTCTCGTACCAGTCTGCAGCGTCGAGATCGAACCGTCACCCCGTGTGTGTGTGTGTGTGTGTGTTTTTTTCCTGC
TGCACTTTCTTTCCTTCTTCTCTCTTCTCTTCCATCTTCTCCGTTCATACCGGGAGGGGGAGGGGATTCTGTTTC
TCTTTTTTTCCCCCCCTTTTCCTCTTCTCTTATCGGCCTCTTGCTCGGTCTGCGACGGCTTGTCCGTGGCGCTAT
CGCCAGCCTCGACTGCTGCGTCTCAGACTGAACATTTCGTCTTTCCTTTGCCTGCCTCCCTGCCCCCTCTCGAAG
GAGGACAAAAAAAAAAAAAAGAGATTCTGTGGCTTCAGCAGAGCCTCCGGCAAATACGCAACGATTTTCATATTT
TTCTCGTGTATGATTTTCTTGCCCGACAATTTTTTTTTTCATCATTATCCACCCTCACGGCATCTCTTTTCCCTG
CCCCATCTTTTCCTTTGTTTATTTTCGCCTCGTCCTCTTCCTCTCTCTTGGCAGATCCATCCTCTGTCGTTTTCT
CCCCCCCTCTCTCTTCCACTCTTTCGCTGACCCTTACCAGCCACCGCCCGTCACTCTCGACGACTGTTTCTCATA
GACTCAGCCAGCCATCCATTTCCATTCCTCACCCTTCATTCCTCTTCGCGCCCCGCCCGTCGGCGGACGAGCGAT
ACGCCGTTCGGTCACGTTTCTTTCTTCTTGTTCCGGCCGTCTCGTTCGACGTCTGCTTGACAGGTATGTATATGA
CATGGGACTCTCTTCCTCTCGCTCGCCGCAAGCGTGGCATTGAGCATAGCTCTTGGCCACTCCCCAAAGTCACAG
TCCTGGCGTCTCGAAGTATCGTCGACAGACTGTCTGCTGCTCGTCCTCCTTCATGGCAGCGACACGGCGCTGGCG
GACCTTCCGCCGGCCCAGCGCCCATGGCCGTCCCGCGTCCGGACCCGGACCCGGACCCGGACCCGGGCCTCGCAC
ATGATATGAGCGGCGCTAACAGGAGTGAGCCATTCCAGGACAAGAGGCCTTCTCGTCTTGCCTCGTTGAACATGT
CGGGCCGGACGAGCCAGGCGCCGACGACATCGGCGGCCGAGAGCCCCTCGACCGCGGCGACGGCCGCCCAGCCGA
CGAGTGAAGAGGCTGCTGCCTCGCTTGCAGCCTCTTCCGCTGCTTCCCCTACCGCCTCACCATCGTCGCCATCCA
CAAACTCGCCGGCGCAAAGCCAGCAGCCGCTGCCCGCCAGTCTCCCCAGCACGTCGGCCGCTCCTCCACCCGCCA
GCTCCTCGCCGTCGTCCAGCTCCTCGTCCACGGAGCAGCGTCCGGCTTCGGTGCCATCGTCTAGCTCCTCGCCGC
CCCAACGTGCCGTGTCGACGCCGAGCTCAGTGCCGCCACAGTCTTCAGCACCTCCCGCCGCCGCCCCTTCCTCCT
CGTCCTCCTCGCAGCAGCCCGACGTCTCTTCGGCCGTCGTCACCGTCACTCCGAGCAATGTGGCCACTAGCGTCC
AGGTGGTGACATCGACGACGACCCGGGCGCCCGTAGGAGGCCCGTCGACGACATCGTCGGCCGCTTCATCGTCGA
CGTCGTCGGCCGCCGCCGAACTCGACTCGTCCAACTCGGCCTCTGGTGGCGGCCTGAACCAGGCGTCCAAGGTGG
CCATCGGTGTTGTGGTGCCCATCGCCGCCATCGCCTTCCTGGCCATCGTCGGTCTCTTTTGGTGGAAGAAGCGGA
GGGCGCGTCAGGAAGCCGAAGAGGAGCGCCGGAAGGAGGTGGAGGACTACTCATACAACCCCAACGCCGACCCCA
CGATGCCTGCTGTCGGCCACTCGGTCGAGCACGCGTACGAGATGAAAGACGAGGGCGGCTACCGCGGCTGGGGCT
CCACCGCCACCACGACGGGCTCCAGAGGACGCAAGGCCTCGACGACAATGTCGGGAGGCGCCGCCGGCACCTACT
CGGACCCGGCGTCGCCCATCCGCGCCAACCTATCCGAGGCGCGGTCCGGCGAGCCGCTCGTGGACGGCTCGTCGA
CGCACGAGGGCGAGATCCTCGGCGCCATGGGGCCGTCGGCGGCCAACAACCGCGGTGGCGACGTGCGTCGAGGGC
CGTCCAACGCCTCGTCTTCCTACAGCGCGGCCGCCCGGTCTGATGGGTCCGACGGCGCCATGTACGGCAACGGCG
CGGCCTATTACGAACAGTACGGCCAGAACCCGTACAGCGAGCAGAGGCCGCAGGAGGCGGGCAGCCAAGCCGTCA
TACGCGACAATCCGGCGAGACGCAATACCCGGATCGAGAACTCGGCGCATTATCCGCAGCAGAGTGCGGGCATTG
CTCAAAACTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail