Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5553
Gene name
Locationscaffold_458:14688..16529
Strand-
Gene length (bp)1841
Transcript length (bp)1665
Coding sequence length (bp)1662
Protein length (aa) 554

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00581 Rhodanese Rhodanese-like domain 1.3E-11 367 463

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30303|MPIP_EMENI M-phase inducer phosphatase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimT PE=2 SV=2 1 554 2.0E-133
sp|P06652|MPIP_SCHPO M-phase inducer phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc25 PE=1 SV=2 329 522 1.0E-53
sp|P23748|MPIP_YEAST M-phase inducer phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIH1 PE=1 SV=2 334 496 2.0E-35
sp|P30305|MPIP2_HUMAN M-phase inducer phosphatase 2 OS=Homo sapiens GN=CDC25B PE=1 SV=2 352 502 1.0E-30
sp|P30309|MPI1B_XENLA M-phase inducer phosphatase 1-B OS=Xenopus laevis GN=cdc25-1-b PE=2 SV=1 352 503 6.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30303|MPIP_EMENI M-phase inducer phosphatase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimT PE=2 SV=2 1 554 2.0E-133
sp|P06652|MPIP_SCHPO M-phase inducer phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc25 PE=1 SV=2 329 522 1.0E-53
sp|P23748|MPIP_YEAST M-phase inducer phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIH1 PE=1 SV=2 334 496 2.0E-35
sp|P30305|MPIP2_HUMAN M-phase inducer phosphatase 2 OS=Homo sapiens GN=CDC25B PE=1 SV=2 352 502 1.0E-30
sp|P30309|MPI1B_XENLA M-phase inducer phosphatase 1-B OS=Xenopus laevis GN=cdc25-1-b PE=2 SV=1 352 503 6.0E-30
sp|P30308|MPI1A_XENLA M-phase inducer phosphatase 1-A OS=Xenopus laevis GN=cdc25-1-a PE=2 SV=1 352 503 2.0E-29
sp|P30306|MPIP2_MOUSE M-phase inducer phosphatase 2 OS=Mus musculus GN=Cdc25b PE=1 SV=1 343 502 3.0E-29
sp|P48964|MPIP1_MOUSE M-phase inducer phosphatase 1 OS=Mus musculus GN=Cdc25a PE=2 SV=2 352 502 3.0E-29
sp|A7MBD1|MPIP1_BOVIN M-phase inducer phosphatase 1 OS=Bos taurus GN=CDC25A PE=2 SV=1 352 502 4.0E-29
sp|P30304|MPIP1_HUMAN M-phase inducer phosphatase 1 OS=Homo sapiens GN=CDC25A PE=1 SV=2 317 502 4.0E-29
sp|P30310|MPIP2_XENLA M-phase inducer phosphatase 2 OS=Xenopus laevis GN=cdc25-2 PE=2 SV=1 352 503 4.0E-29
sp|P48965|MPIP1_RAT M-phase inducer phosphatase 1 OS=Rattus norvegicus GN=Cdc25a PE=1 SV=1 352 502 6.0E-29
sp|A5D7P0|MPIP3_BOVIN M-phase inducer phosphatase 3 OS=Bos taurus GN=CDC25C PE=2 SV=1 349 500 7.0E-29
sp|P48966|MPIP2_RAT M-phase inducer phosphatase 2 OS=Rattus norvegicus GN=Cdc25b PE=1 SV=1 343 512 2.0E-28
sp|P30311|MPIP3_XENLA M-phase inducer phosphatase 3 OS=Xenopus laevis GN=cdc25-3 PE=1 SV=1 352 499 3.0E-28
sp|P30307|MPIP3_HUMAN M-phase inducer phosphatase 3 OS=Homo sapiens GN=CDC25C PE=1 SV=2 349 500 4.0E-28
sp|Q29029|MPIP3_PIG M-phase inducer phosphatase 3 OS=Sus scrofa GN=CDC25C PE=3 SV=1 349 500 4.0E-28
sp|P48967|MPIP3_MOUSE M-phase inducer phosphatase 3 OS=Mus musculus GN=Cdc25c PE=2 SV=2 352 500 6.0E-27
sp|P48968|MPIP3_MESAU M-phase inducer phosphatase 3 OS=Mesocricetus auratus GN=CDC25C PE=2 SV=1 352 500 3.0E-26
sp|P30634|MPIP3_CAEEL M-phase inducer phosphatase cdc-25.3 OS=Caenorhabditis elegans GN=cdc-25.3 PE=3 SV=1 346 485 6.0E-26
sp|P20483|MPIP_DROME M-phase inducer phosphatase OS=Drosophila melanogaster GN=stg PE=1 SV=2 349 502 1.0E-25
sp|O44628|MPIP2_CAEEL M-phase inducer phosphatase cdc-25.2 OS=Caenorhabditis elegans GN=cdc-25.2 PE=3 SV=2 341 484 2.0E-24
sp|Q03019|TWINE_DROME Cdc25-like protein phosphatase twine OS=Drosophila melanogaster GN=twe PE=1 SV=2 292 479 7.0E-24
sp|Q54QM6|MPIP_DICDI M-phase inducer phosphatase OS=Dictyostelium discoideum GN=cdc25 PE=1 SV=1 374 485 2.0E-20
sp|O44552|MPIP1_CAEEL M-phase inducer phosphatase cdc-25.1 OS=Caenorhabditis elegans GN=cdc-25.1 PE=3 SV=1 364 480 1.0E-18
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5553
MEASSPLAALHRPLMPAPSWGGRDVFRPGPHSRYSPALREQLHRGGPDYFSLKEVRGSSPAASLAADLSQNFRLD
NDASPQFPTPRRALFTANMMSGMESRHMVTTPPLPSSSPGPTMELMEMSPLPHKMPFVTHVDMASPTPASTPAVD
EEQDEDEDDYMVLDSPAPIEPPKPIVADRKIAAPRRPSLSRIKCLTTTAVPARAQPEPQPPAFRFGTDRSLSHAS
SSVSLDECFETASPPLDPRPQSANSPCPSIAMASRPRPLFTGPGGHRHGSPLNCHTRRQSNPFLRNRKQFRRSLS
MFETPADIMKSKPDGDESASSSLKSVMDIEEIHEPCLPHFLPDDPSDTIPRVSKETLLDIMDGKYAEKFDQKMVI
DCRFEYEYDGGHIEGAVNHNDKELLATQLFQTPMTGRTLLIFHCEYSAHRAPLMARHVRAQDRTVNAEHYPRLTY
PEVYILEGGYSGFFAHHRSRCFPQEYVEMSDEKHQRTCEREMGRLKARKGLGRAQTFAFGQRESCINDSPTGPSR
PGSRLSSTSTLCEPPPLSERSLARRMASY
Coding >Ophio5|5553
ATGGAGGCATCGTCTCCTCTGGCGGCCTTGCACCGCCCCTTGATGCCTGCTCCCTCCTGGGGAGGCAGAGACGTC
TTTCGCCCGGGCCCGCATTCGCGATACTCGCCAGCCCTCCGCGAGCAGCTGCACAGAGGCGGCCCCGACTACTTC
AGCCTCAAGGAGGTCCGTGGCTCGTCGCCCGCTGCCAGCCTGGCCGCCGACCTGTCCCAGAACTTCCGCCTCGAC
AATGACGCCAGTCCTCAGTTCCCCACGCCCCGTCGGGCCCTCTTCACGGCCAACATGATGAGTGGCATGGAGAGC
AGGCACATGGTGACGACGCCGCCGCTACCCTCGTCGTCGCCAGGCCCTACCATGGAGCTCATGGAGATGTCGCCT
CTGCCTCACAAGATGCCCTTCGTAACGCACGTCGACATGGCGTCGCCTACGCCCGCCTCGACGCCCGCAGTCGAC
GAGGAACAGGACGAAGACGAAGACGACTACATGGTCCTCGACTCCCCGGCCCCGATCGAGCCGCCTAAACCCATC
GTGGCTGATCGCAAGATCGCCGCCCCTCGCCGGCCGTCGCTCAGCCGTATCAAGTGCCTGACAACCACTGCCGTT
CCTGCCAGAGCCCAGCCCGAACCTCAGCCGCCTGCCTTTCGCTTCGGAACCGACCGCAGCCTAAGCCACGCGAGC
TCGAGCGTGTCCCTCGACGAATGCTTCGAGACGGCTTCTCCGCCGCTGGACCCAAGGCCGCAGTCGGCCAACAGT
CCCTGCCCGTCCATCGCCATGGCCTCGCGTCCGCGGCCTCTGTTCACGGGACCCGGTGGCCACCGCCACGGTTCG
CCCCTCAACTGCCACACCAGGAGACAGTCGAACCCGTTCCTGAGGAACCGCAAGCAGTTTCGCCGCTCGCTGAGC
ATGTTCGAGACGCCGGCCGACATCATGAAGTCCAAGCCTGACGGGGACGAGTCCGCCTCTTCTTCTCTCAAGTCC
GTCATGGACATTGAAGAGATTCACGAGCCGTGCCTACCCCACTTTCTGCCGGACGATCCCTCGGACACGATCCCA
CGAGTCAGCAAGGAAACGCTGCTGGACATCATGGACGGGAAGTACGCCGAGAAGTTCGACCAGAAGATGGTCATC
GACTGCCGGTTCGAGTACGAGTACGACGGCGGCCACATCGAGGGCGCCGTCAACCACAACGATAAGGAGCTGCTG
GCCACGCAACTCTTCCAGACTCCCATGACCGGACGTACCCTGCTCATCTTCCACTGCGAGTACTCGGCCCACCGG
GCGCCGCTCATGGCACGCCACGTCCGTGCCCAGGACCGGACGGTCAACGCGGAGCACTACCCCCGCCTGACCTAC
CCTGAGGTCTACATCCTCGAAGGCGGATACAGCGGCTTCTTCGCCCATCACCGCTCGAGGTGCTTTCCCCAGGAA
TACGTTGAGATGTCGGACGAGAAGCATCAGCGCACCTGCGAGCGCGAGATGGGCCGGCTCAAGGCTCGCAAGGGA
CTCGGCCGCGCCCAGACGTTTGCCTTTGGCCAGCGGGAGTCGTGCATCAACGACTCCCCAACCGGCCCTAGCCGG
CCGGGCTCGCGGCTCTCCTCGACGTCGACGCTCTGCGAGCCGCCGCCCCTCAGCGAGCGATCGCTGGCCCGACGG
ATGGCGTCCTAC
Transcript >Ophio5|5553
ATGGAGGCATCGTCTCCTCTGGCGGCCTTGCACCGCCCCTTGATGCCTGCTCCCTCCTGGGGAGGCAGAGACGTC
TTTCGCCCGGGCCCGCATTCGCGATACTCGCCAGCCCTCCGCGAGCAGCTGCACAGAGGCGGCCCCGACTACTTC
AGCCTCAAGGAGGTCCGTGGCTCGTCGCCCGCTGCCAGCCTGGCCGCCGACCTGTCCCAGAACTTCCGCCTCGAC
AATGACGCCAGTCCTCAGTTCCCCACGCCCCGTCGGGCCCTCTTCACGGCCAACATGATGAGTGGCATGGAGAGC
AGGCACATGGTGACGACGCCGCCGCTACCCTCGTCGTCGCCAGGCCCTACCATGGAGCTCATGGAGATGTCGCCT
CTGCCTCACAAGATGCCCTTCGTAACGCACGTCGACATGGCGTCGCCTACGCCCGCCTCGACGCCCGCAGTCGAC
GAGGAACAGGACGAAGACGAAGACGACTACATGGTCCTCGACTCCCCGGCCCCGATCGAGCCGCCTAAACCCATC
GTGGCTGATCGCAAGATCGCCGCCCCTCGCCGGCCGTCGCTCAGCCGTATCAAGTGCCTGACAACCACTGCCGTT
CCTGCCAGAGCCCAGCCCGAACCTCAGCCGCCTGCCTTTCGCTTCGGAACCGACCGCAGCCTAAGCCACGCGAGC
TCGAGCGTGTCCCTCGACGAATGCTTCGAGACGGCTTCTCCGCCGCTGGACCCAAGGCCGCAGTCGGCCAACAGT
CCCTGCCCGTCCATCGCCATGGCCTCGCGTCCGCGGCCTCTGTTCACGGGACCCGGTGGCCACCGCCACGGTTCG
CCCCTCAACTGCCACACCAGGAGACAGTCGAACCCGTTCCTGAGGAACCGCAAGCAGTTTCGCCGCTCGCTGAGC
ATGTTCGAGACGCCGGCCGACATCATGAAGTCCAAGCCTGACGGGGACGAGTCCGCCTCTTCTTCTCTCAAGTCC
GTCATGGACATTGAAGAGATTCACGAGCCGTGCCTACCCCACTTTCTGCCGGACGATCCCTCGGACACGATCCCA
CGAGTCAGCAAGGAAACGCTGCTGGACATCATGGACGGGAAGTACGCCGAGAAGTTCGACCAGAAGATGGTCATC
GACTGCCGGTTCGAGTACGAGTACGACGGCGGCCACATCGAGGGCGCCGTCAACCACAACGATAAGGAGCTGCTG
GCCACGCAACTCTTCCAGACTCCCATGACCGGACGTACCCTGCTCATCTTCCACTGCGAGTACTCGGCCCACCGG
GCGCCGCTCATGGCACGCCACGTCCGTGCCCAGGACCGGACGGTCAACGCGGAGCACTACCCCCGCCTGACCTAC
CCTGAGGTCTACATCCTCGAAGGCGGATACAGCGGCTTCTTCGCCCATCACCGCTCGAGGTGCTTTCCCCAGGAA
TACGTTGAGATGTCGGACGAGAAGCATCAGCGCACCTGCGAGCGCGAGATGGGCCGGCTCAAGGCTCGCAAGGGA
CTCGGCCGCGCCCAGACGTTTGCCTTTGGCCAGCGGGAGTCGTGCATCAACGACTCCCCAACCGGCCCTAGCCGG
CCGGGCTCGCGGCTCTCCTCGACGTCGACGCTCTGCGAGCCGCCGCCCCTCAGCGAGCGATCGCTGGCCCGACGG
ATGGCGTCCTACTGA
Gene >Ophio5|5553
ATGGAGGCATCGTCTCCTCTGGCGGCCTTGCACCGCCCCTTGATGCCTGCTCCCTCCTGGGGAGGCAGAGACGTC
TTTCGCCCGGGCCCGCATTCGCGATACTCGCCAGCCCTCCGCGAGCAGCTGCACAGAGGCGGCCCCGACTACTTC
AGCCTCAAGGAGGTCCGTGGCTCGTCGCCCGCTGCCAGCCTGGCCGCCGACCTGTCCCAGAACTTCCGCCTCGAC
AATGACGCCAGGTTTGTGCCGGCCCTGTCTCGGTCGTCATTCGCTTGCTGACGTCGGGCCATCCCTAGTCCTCAG
TTCCCCACGCCCCGTCGGGCCCTCTTCACGGCCAACATGATGAGTGGCATGGAGAGCAGGCGTGAGAATTCCCCG
TCTGCAAGCCTAGCGCTCCCTCCGCTGACCTCCCGACTAAGACATGGTGACGACGCCGCCGCTACCCTCGTCGTC
GCCAGGCCCTACCATGGAGCTCATGGAGATGTCGCCTCTGCCTCACAAGATGCCCTTCGTAACGCACGTCGACAT
GGCGTCGCCTACGCCCGCCTCGACGCCCGCAGTCGACGAGGAACAGGACGAAGACGAAGACGACTACATGGTCCT
CGACTCCCCGGCCCCGATCGAGCCGCCTAAACCCATCGTGGCTGAGTCAGTGCCCAGATGAGCATTCCGATCATC
TCCAGAGCAAGCAATACTGACAGTTCCGCCGCAGTCGCAAGATCGCCGCCCCTCGCCGGCCGTCGCTCAGCCGTA
TCAAGTGCCTGACAACCACTGCCGTTCCTGCCAGAGCCCAGCCCGAACCTCAGCCGCCTGCCTTTCGCTTCGGAA
CCGACCGCAGCCTAAGCCACGCGAGCTCGAGCGTGTCCCTCGACGAATGCTTCGAGACGGCTTCTCCGCCGCTGG
ACCCAAGGCCGCAGTCGGCCAACAGTCCCTGCCCGTCCATCGCCATGGCCTCGCGTCCGCGGCCTCTGTTCACGG
GACCCGGTGGCCACCGCCACGGTTCGCCCCTCAACTGCCACACCAGGAGACAGTCGAACCCGTTCCTGAGGAACC
GCAAGCAGTTTCGCCGCTCGCTGAGCATGTTCGAGACGCCGGCCGACATCATGAAGTCCAAGCCTGACGGGGACG
AGTCCGCCTCTTCTTCTCTCAAGTCCGTCATGGACATTGAAGAGATTCACGAGCCGTGCCTACCCCACTTTCTGC
CGGACGATCCCTCGGACACGATCCCACGAGTCAGCAAGGAAACGCTGCTGGACATCATGGACGGGAAGTACGCCG
AGAAGTTCGACCAGAAGATGGTCATCGACTGCCGGTTCGAGTACGAGTACGACGGCGGCCACATCGAGGGCGCCG
TCAACCACAACGATAAGGAGCTGCTGGCCACGCAACTCTTCCAGACTCCCATGACCGGACGTACCCTGCTCATCT
TCCACTGCGAGTACTCGGCCCACCGGGCGCCGCTCATGGCACGCCACGTCCGTGCCCAGGACCGGACGGTCAACG
CGGAGCACTACCCCCGCCTGACCTACCCTGAGGTCTACATCCTCGAAGGCGGATACAGCGGCTTCTTCGCCCATC
ACCGCTCGAGGTGCTTTCCCCAGGAATACGTTGAGATGTCGGACGAGAAGCATCAGCGCACCTGCGAGCGCGAGA
TGGGCCGGCTCAAGGCTCGCAAGGGACTCGGCCGCGCCCAGACGTTTGCCTTTGGCCAGCGGGAGTCGTGCATCA
ACGACTCCCCAACCGGCCCTAGCCGGCCGGGCTCGCGGCTCTCCTCGACGTCGACGCTCTGCGAGCCGCCGCCCC
TCAGCGAGCGATCGCTGGCCCGACGGATGGCGTCCTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail