Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5552
Gene name
Locationscaffold_458:11601..13305
Strand+
Gene length (bp)1704
Transcript length (bp)1509
Coding sequence length (bp)1506
Protein length (aa) 502

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04677 CwfJ_C_1 Protein similar to CwfJ C-terminus 1 2.6E-22 262 388
PF04676 CwfJ_C_2 Protein similar to CwfJ C-terminus 2 1.6E-17 424 500

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10414|MU161_SCHPO CWF19-like protein mug161 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug161 PE=1 SV=1 6 500 9.0E-63
sp|A1Z8J0|C19L1_DROME CWF19-like protein 1 homolog OS=Drosophila melanogaster GN=CG7741 PE=2 SV=1 5 500 1.0E-40
sp|P53255|DRN1_YEAST CWF19-like protein DRN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRN1 PE=1 SV=1 1 502 1.0E-37
sp|Q8AVL0|C19L1_XENLA CWF19-like protein 1 OS=Xenopus laevis GN=cwf19l1 PE=2 SV=1 5 501 9.0E-34
sp|Q8CI33|C19L1_MOUSE CWF19-like protein 1 OS=Mus musculus GN=Cwf19l1 PE=1 SV=2 5 501 3.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10414|MU161_SCHPO CWF19-like protein mug161 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug161 PE=1 SV=1 6 500 9.0E-63
sp|A1Z8J0|C19L1_DROME CWF19-like protein 1 homolog OS=Drosophila melanogaster GN=CG7741 PE=2 SV=1 5 500 1.0E-40
sp|P53255|DRN1_YEAST CWF19-like protein DRN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRN1 PE=1 SV=1 1 502 1.0E-37
sp|Q8AVL0|C19L1_XENLA CWF19-like protein 1 OS=Xenopus laevis GN=cwf19l1 PE=2 SV=1 5 501 9.0E-34
sp|Q8CI33|C19L1_MOUSE CWF19-like protein 1 OS=Mus musculus GN=Cwf19l1 PE=1 SV=2 5 501 3.0E-33
sp|Q5RGJ5|C19L1_DANRE CWF19-like protein 1 OS=Danio rerio GN=cwf19l1 PE=2 SV=1 5 501 4.0E-30
sp|Q69YN2|C19L1_HUMAN CWF19-like protein 1 OS=Homo sapiens GN=CWF19L1 PE=1 SV=2 5 501 2.0E-29
sp|Q5R8R4|C19L1_PONAB CWF19-like protein 1 OS=Pongo abelii GN=CWF19L1 PE=2 SV=1 5 501 4.0E-29
sp|O16216|C19L1_CAEEL CWF19-like protein 1 homolog OS=Caenorhabditis elegans GN=F17A9.2 PE=3 SV=2 5 500 4.0E-29
sp|Q84WU9|C3H64_ARATH Zinc finger CCCH domain-containing protein 64 OS=Arabidopsis thaliana GN=At5g56900 PE=2 SV=1 4 498 1.0E-24
sp|Q69NK8|C3H59_ORYSJ Zinc finger CCCH domain-containing protein 59 OS=Oryza sativa subsp. japonica GN=Os09g0364000 PE=2 SV=1 251 498 3.0E-20
sp|Q69NK8|C3H59_ORYSJ Zinc finger CCCH domain-containing protein 59 OS=Oryza sativa subsp. japonica GN=Os09g0364000 PE=2 SV=1 5 249 1.0E-10
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3393 0.9453 0.0998 0.0123 0.0795 0.0025 0.0337 0.0075 0.0068 0.0037

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4013
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6879
Ophiocordyceps australis map64 (Brazil) OphauB2|4306
Ophiocordyceps camponoti-floridani Ophcf2|00374
Ophiocordyceps camponoti-rufipedis Ophun1|3114
Ophiocordyceps kimflemingae Ophio5|5552 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8065

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5552
MTNPKIIVLGSLNGELEQAAQKLATLQAKNGFSIAILTGNVFAPTLDAEVLEALKSGKLAFALPTYFTVGTHPLP
EQIAAKVEADEEIGQNLYFLGKRGVTTTADGIRIAVLGGIPAHPETTWREPCRSPPDSSRAIAELCASLKPRYAL
SASPGSFFYEREAFEHPFTTEAESDVRAFTRFISLAPYGNAAKAKAMYAFSLNRSDDGAVPPGVTSSPLAVAAHS
KKRPRGDDSYSRFGGYHDDHGRAGRRGKRRQAQPPPGPDRCYFCLSNPDISTHMCCSIGDESYVTTAKGPLPTPT
TFAEHGLTFPGHFIIIPLPHAPTATAMGTADEAARTYDEMSRFRDALQAMLATTSSHKLGAVTWEISRERNVHLI
WQLMALPAQLIQSGVAEAAFRVEAENQAYPAFVADDLPLSRQAAYGDFFCVWLWADNGEDKIKGKSLVMPLTQDL
RFDLQFGRRVVAKLLGLDARFVWQECQQTVEEETRDVQAFRQAFKEWDFTLA
Coding >Ophio5|5552
ATGACGAACCCGAAGATCATCGTTCTCGGCAGCCTGAATGGCGAGCTTGAGCAGGCAGCGCAGAAGCTCGCAACG
CTGCAAGCCAAGAACGGCTTCTCGATAGCCATCCTGACGGGAAACGTCTTCGCACCTACTCTCGATGCCGAAGTA
CTCGAAGCGTTGAAGAGCGGAAAGTTGGCGTTTGCGCTCCCCACCTACTTCACCGTCGGCACTCACCCACTGCCC
GAGCAGATCGCGGCCAAAGTCGAGGCTGACGAAGAGATCGGCCAAAATCTGTACTTTCTCGGAAAGCGTGGCGTC
ACTACTACAGCGGATGGTATTCGCATCGCCGTCCTCGGCGGGATACCCGCGCATCCCGAGACGACGTGGCGCGAG
CCGTGCCGATCTCCTCCTGACAGCTCTCGAGCGATTGCGGAGCTTTGCGCATCTCTCAAGCCTCGCTATGCCCTC
TCAGCATCTCCCGGCTCATTTTTCTACGAGCGTGAAGCATTTGAGCACCCGTTCACGACGGAAGCAGAATCGGAT
GTCAGGGCCTTTACGCGCTTCATCTCTTTGGCCCCGTACGGCAACGCAGCCAAGGCCAAGGCCATGTACGCCTTC
AGCCTCAACAGGTCCGACGACGGCGCCGTGCCACCTGGAGTCACGAGCTCGCCTCTCGCCGTCGCCGCACACTCG
AAGAAGCGGCCGAGAGGGGACGACTCTTACAGCCGCTTCGGCGGCTATCACGACGACCACGGCCGCGCTGGCCGT
CGGGGTAAAAGACGTCAGGCGCAGCCGCCTCCCGGACCAGACCGCTGCTACTTCTGCCTCTCGAACCCAGACATC
TCAACGCACATGTGCTGCAGCATCGGAGACGAGTCGTACGTGACGACGGCAAAGGGCCCCTTGCCGACGCCCACG
ACCTTTGCCGAGCACGGCCTGACCTTCCCGGGCCACTTCATCATCATCCCCCTCCCGCACGCACCCACAGCCACA
GCCATGGGCACGGCAGACGAAGCGGCGCGAACGTACGACGAGATGTCCCGCTTCCGCGACGCCCTGCAGGCCATG
CTAGCCACTACCTCTTCCCATAAGCTCGGCGCCGTGACCTGGGAGATCAGCCGCGAGCGCAACGTCCACCTCATC
TGGCAGCTCATGGCTCTACCCGCGCAGCTGATCCAAAGCGGCGTCGCCGAGGCCGCCTTTCGCGTCGAGGCCGAG
AACCAGGCCTATCCGGCCTTCGTGGCCGATGACCTTCCCCTCTCGCGACAGGCCGCCTACGGTGACTTCTTCTGC
GTCTGGCTCTGGGCCGACAATGGCGAGGACAAGATTAAGGGCAAGTCTCTCGTCATGCCGCTGACCCAGGACCTG
CGCTTTGACCTGCAGTTCGGTCGTCGCGTCGTTGCTAAGCTCTTGGGCCTTGATGCCCGCTTCGTCTGGCAGGAG
TGCCAGCAGACGGTTGAAGAGGAGACGCGCGACGTCCAGGCCTTCCGTCAGGCCTTTAAGGAGTGGGACTTTACC
CTCGCC
Transcript >Ophio5|5552
ATGACGAACCCGAAGATCATCGTTCTCGGCAGCCTGAATGGCGAGCTTGAGCAGGCAGCGCAGAAGCTCGCAACG
CTGCAAGCCAAGAACGGCTTCTCGATAGCCATCCTGACGGGAAACGTCTTCGCACCTACTCTCGATGCCGAAGTA
CTCGAAGCGTTGAAGAGCGGAAAGTTGGCGTTTGCGCTCCCCACCTACTTCACCGTCGGCACTCACCCACTGCCC
GAGCAGATCGCGGCCAAAGTCGAGGCTGACGAAGAGATCGGCCAAAATCTGTACTTTCTCGGAAAGCGTGGCGTC
ACTACTACAGCGGATGGTATTCGCATCGCCGTCCTCGGCGGGATACCCGCGCATCCCGAGACGACGTGGCGCGAG
CCGTGCCGATCTCCTCCTGACAGCTCTCGAGCGATTGCGGAGCTTTGCGCATCTCTCAAGCCTCGCTATGCCCTC
TCAGCATCTCCCGGCTCATTTTTCTACGAGCGTGAAGCATTTGAGCACCCGTTCACGACGGAAGCAGAATCGGAT
GTCAGGGCCTTTACGCGCTTCATCTCTTTGGCCCCGTACGGCAACGCAGCCAAGGCCAAGGCCATGTACGCCTTC
AGCCTCAACAGGTCCGACGACGGCGCCGTGCCACCTGGAGTCACGAGCTCGCCTCTCGCCGTCGCCGCACACTCG
AAGAAGCGGCCGAGAGGGGACGACTCTTACAGCCGCTTCGGCGGCTATCACGACGACCACGGCCGCGCTGGCCGT
CGGGGTAAAAGACGTCAGGCGCAGCCGCCTCCCGGACCAGACCGCTGCTACTTCTGCCTCTCGAACCCAGACATC
TCAACGCACATGTGCTGCAGCATCGGAGACGAGTCGTACGTGACGACGGCAAAGGGCCCCTTGCCGACGCCCACG
ACCTTTGCCGAGCACGGCCTGACCTTCCCGGGCCACTTCATCATCATCCCCCTCCCGCACGCACCCACAGCCACA
GCCATGGGCACGGCAGACGAAGCGGCGCGAACGTACGACGAGATGTCCCGCTTCCGCGACGCCCTGCAGGCCATG
CTAGCCACTACCTCTTCCCATAAGCTCGGCGCCGTGACCTGGGAGATCAGCCGCGAGCGCAACGTCCACCTCATC
TGGCAGCTCATGGCTCTACCCGCGCAGCTGATCCAAAGCGGCGTCGCCGAGGCCGCCTTTCGCGTCGAGGCCGAG
AACCAGGCCTATCCGGCCTTCGTGGCCGATGACCTTCCCCTCTCGCGACAGGCCGCCTACGGTGACTTCTTCTGC
GTCTGGCTCTGGGCCGACAATGGCGAGGACAAGATTAAGGGCAAGTCTCTCGTCATGCCGCTGACCCAGGACCTG
CGCTTTGACCTGCAGTTCGGTCGTCGCGTCGTTGCTAAGCTCTTGGGCCTTGATGCCCGCTTCGTCTGGCAGGAG
TGCCAGCAGACGGTTGAAGAGGAGACGCGCGACGTCCAGGCCTTCCGTCAGGCCTTTAAGGAGTGGGACTTTACC
CTCGCCTAG
Gene >Ophio5|5552
ATGACGAACCCGAAGATGTAATACTCTCTTGCTCGCACATCTCTTCATCTTTCGTCACGCGCTGATTCCATTTCT
CGCAGCATCGTTCTCGGCAGCCTGAATGGCGAGCTTGAGCAGGCAGCGCAGAAGCTCGCAACGCTGCAAGCCAAG
AACGGCTTCTCGATAGCCATCCTGACGGGAAACGTCTTCGCACCTACTCTCGATGCCGAAGTACTCGAAGCGTTG
AAGAGCGGAAAGTTGGCGTTTGCGCTCCCCACCTACTTCACCGTCGGCACTCACCCACTGCCCGAGCAGATCGCG
GCCAAAGTCGAGGCTGACGAAGAGATCGGCCAAAATCTGTACTTTCTCGGAAAGCGTGGCGTCACTACTACAGCG
GATGGTATTCGCATCGCCGTCCTCGGCGGGATACCCGCGCATCCCGAGACGACGTCGGACGGGGAACAGCATCTG
CATTTCCACACAGACGAGGATGCAAAGGCGCTACAAGGTGGCGCGAGCCGTGCCGATCTCCTCCTGACGTCCGTC
TGGCCGGCCGACGTTTGGCGTCGCTCCAACGTTGTTCTCGAACCGGCTAACCAGGCCGCTGTGCAGAGCTCTCGA
GCGATTGCGGAGCTTTGCGCATCTCTCAAGCCTCGCTATGCCCTCTCAGCATCTCCCGGCTCATTTTTCTACGAG
CGTGAAGCATTTGAGCACCCGTTCACGACGGAAGCAGAATCGGATGTCAGGGCCTTTACGCGCTTCATCTCTTTG
GCCCCGTACGGCAACGCAGCCAAGGCCAAGGCCATGTACGCCTTCAGCCTCAACAGGTCCGACGACGGCGCCGTG
CCACCTGGAGTCACGAGCTCGCCTCTCGCCGTCGCCGCACACTCGAAGAAGCGGCCGAGAGGGGACGACTCTTAC
AGCCGCTTCGGCGGCTATCACGACGACCACGGCCGCGCTGGCCGTCGGGGTAAAAGACGTCAGGCGCAGCCGCCT
CCCGGACCAGACCGCTGCTACTTCTGCCTCTCGAACCCAGACATCTCAACGCACATGTGCTGCAGCATCGGAGAC
GAGTCGTACGTGACGACGGCAAAGGGCCCCTTGCCGACGCCCACGACCTTTGCCGAGCACGGCCTGACCTTCCCG
GGCCACTTCATCATCATCCCCCTCCCGCACGCACCCACAGCCACAGCCATGGGCACGGCAGACGAAGCGGCGCGA
ACGTACGACGAGATGTCCCGCTTCCGCGACGCCCTGCAGGCCATGCTAGCCACTACCTCTTCCCATAAGCTCGGC
GCCGTGACCTGGGAGATCAGCCGCGAGCGCAACGTCCACCTCATCTGGCAGCTCATGGCTCTACCCGCGCAGCTG
ATCCAAAGCGGCGTCGCCGAGGCCGCCTTTCGCGTCGAGGCCGAGAACCAGGCCTATCCGGCCTTCGTGGCCGAT
GACCTTCCCCTCTCGCGACAGGCCGCCTACGGTGACTTCTTCTGCGTCTGGCTCTGGGCCGACAATGGCGAGGAC
AAGATTAAGGGCAAGTCTCTCGTCATGCCGCTGACCCAGGACCTGCGCTTTGACCTGCAGTTCGGTCGTCGCGTC
GTTGCTAAGCTCTTGGGCCTTGATGCCCGCTTCGTCTGGCAGGAGTGCCAGCAGACGGTTGAAGAGGAGACGCGC
GACGTCCAGGCCTTCCGTCAGGCCTTTAAGGAGTGGGACTTTACCCTCGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail