Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5548
Gene name
Locationscaffold_457:14396..16149
Strand+
Gene length (bp)1753
Transcript length (bp)1569
Coding sequence length (bp)1566
Protein length (aa) 522

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04515 Choline_transpo Plasma-membrane choline transporter 2.7E-79 177 495

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I8E9|PNS1_GIBZE Protein PNS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PNS1 PE=3 SV=1 48 522 0.0E+00
sp|Q4WYG7|PNS1_ASPFU Protein pns1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pns1 PE=3 SV=1 20 520 5.0E-178
sp|Q870V7|PNS1_NEUCR Protein PNS1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pns-1 PE=3 SV=1 14 520 1.0E-171
sp|Q6C938|PNS1_YARLI Protein PNS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PNS1 PE=3 SV=1 12 521 7.0E-118
sp|Q6BIV4|PNS1_DEBHA Protein PNS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PNS1 PE=3 SV=2 27 519 1.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I8E9|PNS1_GIBZE Protein PNS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PNS1 PE=3 SV=1 48 522 0.0E+00
sp|Q4WYG7|PNS1_ASPFU Protein pns1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pns1 PE=3 SV=1 20 520 5.0E-178
sp|Q870V7|PNS1_NEUCR Protein PNS1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pns-1 PE=3 SV=1 14 520 1.0E-171
sp|Q6C938|PNS1_YARLI Protein PNS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PNS1 PE=3 SV=1 12 521 7.0E-118
sp|Q6BIV4|PNS1_DEBHA Protein PNS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PNS1 PE=3 SV=2 27 519 1.0E-103
sp|Q12412|PNS1_YEAST Protein PNS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PNS1 PE=1 SV=1 10 519 3.0E-102
sp|Q6CY85|PNS1_KLULA Protein PNS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PNS1 PE=3 SV=1 8 519 1.0E-100
sp|Q5AB93|PNS1_CANAL Protein PNS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PNS1 PE=3 SV=1 33 519 6.0E-95
sp|Q75EG5|PNS1_ASHGO Protein PNS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PNS1 PE=3 SV=1 14 515 3.0E-93
sp|Q6FLC9|PNS1_CANGA Protein PNS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PNS1 PE=3 SV=1 16 519 4.0E-91
sp|Q4PIP8|PNS1_USTMA Protein PNS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PNS1 PE=3 SV=2 15 520 8.0E-86
sp|P0CM92|PNS1_CRYNJ Protein PNS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PNS1 PE=3 SV=1 29 519 1.0E-79
sp|P0CM93|PNS1_CRYNB Protein PNS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PNS1 PE=3 SV=1 29 519 1.0E-79
sp|Q869R1|CTLHB_DICDI CTL-like protein DDB_G0274487 OS=Dictyostelium discoideum GN=DDB_G0274487 PE=3 SV=1 58 506 3.0E-38
sp|Q54IJ2|CTLHA_DICDI CTL-like protein DDB_G0288717 OS=Dictyostelium discoideum GN=DDB_G0288717 PE=3 SV=1 78 517 6.0E-21
sp|A8XKF2|CTL1L_CAEBR Choline transporter-like protein 1 OS=Caenorhabditis briggsae GN=chtl-1 PE=3 SV=2 251 495 7.0E-16
sp|Q55CN8|CTLHC_DICDI CTL-like protein DDB_G0269978 OS=Dictyostelium discoideum GN=DDB_G0269978 PE=3 SV=1 78 410 2.0E-15
sp|Q20026|CTL1L_CAEEL Choline transporter-like protein 1 OS=Caenorhabditis elegans GN=chtl-1 PE=3 SV=1 251 495 9.0E-15
sp|A5D7H3|CTL2_BOVIN Choline transporter-like protein 2 OS=Bos taurus GN=SLC44A2 PE=2 SV=1 244 489 6.0E-13
sp|Q810F1|CTL2_CAVPO Choline transporter-like protein 2 OS=Cavia porcellus GN=SLC44A2 PE=1 SV=1 265 489 6.0E-12
sp|F1S584|CTL2_PIG Choline transporter-like protein 2 OS=Sus scrofa GN=SLC44A2 PE=3 SV=1 265 489 8.0E-12
sp|B0JZD0|CTL5_XENTR Choline transporter-like protein 5 OS=Xenopus tropicalis GN=slc44a5 PE=2 SV=1 273 495 1.0E-11
sp|B4F795|CTL2_RAT Choline transporter-like protein 2 OS=Rattus norvegicus GN=Slc44a2 PE=2 SV=1 177 489 1.0E-11
sp|Q8BY89|CTL2_MOUSE Choline transporter-like protein 2 OS=Mus musculus GN=Slc44a2 PE=1 SV=2 127 489 2.0E-11
sp|Q5R5L9|CTL2_PONAB Choline transporter-like protein 2 OS=Pongo abelii GN=SLC44A2 PE=2 SV=1 244 495 3.0E-11
sp|Q8IWA5|CTL2_HUMAN Choline transporter-like protein 2 OS=Homo sapiens GN=SLC44A2 PE=1 SV=3 244 489 4.0E-11
sp|Q95JW2|CTL5_MACFA Choline transporter-like protein 5 OS=Macaca fascicularis GN=SLC44A5 PE=2 SV=1 177 489 8.0E-11
sp|A5PMW0|CTL5A_DANRE Choline transporter-like protein 5-A (Fragment) OS=Danio rerio GN=slc44a5a PE=3 SV=1 281 495 2.0E-10
sp|Q6IP59|CTL2_XENLA Choline transporter-like protein 2 OS=Xenopus laevis GN=slc44a2 PE=2 SV=1 127 489 3.0E-10
sp|Q53GD3|CTL4_HUMAN Choline transporter-like protein 4 OS=Homo sapiens GN=SLC44A4 PE=2 SV=2 273 489 1.0E-09
sp|Q7SYC9|CTL2_DANRE Choline transporter-like protein 2 OS=Danio rerio GN=slc44a2 PE=2 SV=1 273 518 1.0E-09
sp|A3KMY4|CTL4_BOVIN Choline transporter-like protein 4 OS=Bos taurus GN=SLC44A4 PE=2 SV=1 255 489 2.0E-09
sp|Q8NCS7|CTL5_HUMAN Choline transporter-like protein 5 OS=Homo sapiens GN=SLC44A5 PE=2 SV=4 272 442 2.0E-09
sp|Q91VA1|CTL4_MOUSE Choline transporter-like protein 4 OS=Mus musculus GN=Slc44a4 PE=1 SV=1 273 489 3.0E-09
sp|A5PF08|CTL4_PIG Choline transporter-like protein 4 OS=Sus scrofa GN=SLC44A4 PE=3 SV=1 273 489 3.0E-09
sp|Q5RJI2|CTL5_MOUSE Choline transporter-like protein 5 OS=Mus musculus GN=Slc44a5 PE=2 SV=1 273 489 3.0E-09
sp|Q7T2B0|CTL4_DANRE Choline transporter-like protein 4 OS=Danio rerio GN=slc44a4 PE=2 SV=1 274 442 4.0E-09
sp|Q6GN42|CTL4_XENLA Choline transporter-like protein 4 OS=Xenopus laevis GN=slc44a4 PE=2 SV=1 287 442 4.0E-09
sp|B0S5A7|CTL5B_DANRE Choline transporter-like protein 5-B (Fragment) OS=Danio rerio GN=slc44a5b PE=3 SV=1 281 489 9.0E-09
sp|Q6MG71|CTL4_RAT Choline transporter-like protein 4 OS=Rattus norvegicus GN=Slc44a4 PE=2 SV=1 248 406 4.0E-08
sp|Q54I48|CTL2_DICDI Choline transporter-like protein 2 OS=Dictyostelium discoideum GN=slc44a2 PE=3 SV=1 273 495 4.0E-08
sp|Q17JQ7|CTLH1_AEDAE CTL-like protein 1 OS=Aedes aegypti GN=AAEL001935 PE=3 SV=1 275 517 8.0E-08
sp|B5X3W7|CTL2_SALSA Choline transporter-like protein 2 OS=Salmo salar GN=slc44a2 PE=2 SV=1 265 507 9.0E-08
sp|Q7Q5R7|CTLH1_ANOGA CTL-like protein 1 OS=Anopheles gambiae GN=AGAP006244 PE=3 SV=4 275 496 1.0E-07
sp|Q9VAP3|CTLH2_DROME CTL-like protein 2 OS=Drosophila melanogaster GN=CG11880 PE=3 SV=1 268 489 7.0E-07
sp|Q7PRJ0|CTLH2_ANOGA CTL-like protein 2 OS=Anopheles gambiae GN=AGAP010343 PE=3 SV=4 309 489 1.0E-06
sp|Q6IR74|CTL1_XENLA Choline transporter-like protein 1 OS=Xenopus laevis GN=slc44a1 PE=2 SV=2 275 509 4.0E-06
sp|Q8WWI5|CTL1_HUMAN Choline transporter-like protein 1 OS=Homo sapiens GN=SLC44A1 PE=1 SV=1 275 509 6.0E-06
sp|Q6X893|CTL1_MOUSE Choline transporter-like protein 1 OS=Mus musculus GN=Slc44a1 PE=1 SV=3 275 509 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

Domain # Start End Length
1 84 106 22
2 119 141 22
3 146 168 22
4 173 195 22
5 222 244 22
6 256 278 22
7 315 337 22
8 357 379 22
9 419 441 22
10 454 476 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5548
MNKADGYSGPAQQPPPQQYGQQSYYYGGDQGHQAYPPQDAYNHPQPSYAPPPPYSFNPPQPNDDKYSFEQAFKID
GPKYNDLWAGILFLLVFAGFVFVSAFSIRGWSTRGGSVAVPSNTVVLFAYILLVALVLSYVYVWMARLFPIQFIW
VTGILNLVWTIGTGIYYLSIRSYGPGIIFLIMGVFFIFAFWTWIPRIPFSALMLKTSIDVSKRYGHVYLVSLLGG
LVAVGLAAWYGVSVIAIYARFGPDRNCNSQASSCSSGTAIGLIAFVTFAMYWVSEWLKNTVHTTISGVFGSWYFC
PHNFPKAATRGALKRSLTYSFGSISLGSLLVAIVNFLRQVCSIAGQQAANDGGVMDIAFYVISLLVGCLLMLLEW
LISFVNRYAFSYIALYGKAYFPAAKDTWKMIRDRGVDALVNECLIGPVLSFGAIFIGAACTLLAFLYVRLVQGDM
GRNVSYLAAVMAFAFLVGFQIANIFTTPLSSGIDTIFVATGWDPQVLYSEHPELYQDMVRVYPQVQQAIRVR
Coding >Ophio5|5548
ATGAACAAGGCAGACGGCTACTCGGGCCCTGCCCAGCAGCCGCCGCCGCAACAGTACGGCCAGCAGAGCTACTAC
TACGGGGGCGACCAAGGCCATCAGGCCTACCCTCCCCAGGACGCTTACAACCATCCTCAGCCCTCTTACGCGCCC
CCGCCGCCCTATAGCTTCAACCCCCCACAGCCAAATGACGACAAATACTCGTTCGAACAAGCCTTCAAAATCGAT
GGTCCCAAGTACAATGACCTCTGGGCTGGTATTCTGTTCCTCCTCGTCTTCGCTGGCTTTGTCTTCGTCTCCGCT
TTCTCCATCCGCGGCTGGAGCACTAGAGGTGGGAGTGTCGCCGTCCCAAGCAACACCGTCGTTCTCTTCGCCTAT
ATTCTGCTTGTCGCTCTGGTCCTCTCATACGTCTACGTCTGGATGGCCCGCCTATTTCCCATACAGTTCATCTGG
GTCACCGGAATCCTCAACCTCGTCTGGACCATCGGCACCGGCATCTACTATCTGTCTATCCGGAGCTATGGCCCC
GGTATCATCTTTCTCATCATGGGTGTCTTCTTTATCTTCGCCTTCTGGACCTGGATCCCGCGCATACCCTTTTCT
GCCTTGATGCTCAAGACGTCAATCGATGTGAGCAAGCGCTATGGACACGTCTATCTCGTCAGCCTGCTTGGTGGA
CTCGTCGCCGTTGGTTTGGCCGCCTGGTACGGCGTGAGCGTCATTGCCATCTACGCCCGTTTCGGACCCGACCGC
AACTGCAACTCGCAAGCAAGTAGCTGCAGCAGCGGCACCGCCATTGGCCTCATCGCCTTTGTCACCTTTGCCATG
TACTGGGTATCCGAGTGGCTGAAGAACACGGTACACACCACCATCTCCGGCGTCTTTGGCTCATGGTACTTCTGC
CCTCACAATTTCCCCAAGGCCGCTACACGCGGCGCCTTGAAGCGTTCCCTCACCTACAGCTTTGGCTCCATCAGC
TTGGGGAGTTTGCTCGTAGCCATTGTCAACTTTCTGCGCCAGGTCTGCTCCATCGCCGGTCAGCAGGCCGCCAAT
GACGGCGGAGTCATGGACATTGCCTTTTACGTTATTTCTCTTTTAGTCGGCTGTCTCCTGATGCTCCTCGAATGG
CTGATCAGTTTCGTCAACCGGTACGCCTTTTCGTACATTGCTCTGTACGGGAAGGCCTACTTTCCCGCGGCCAAG
GACACGTGGAAGATGATCAGGGATCGCGGTGTCGACGCCCTGGTCAACGAATGTCTCATCGGACCCGTGCTTTCG
TTTGGGGCCATTTTCATAGGCGCCGCTTGCACCCTACTCGCCTTTCTCTATGTTCGACTTGTACAAGGGGACATG
GGGAGGAATGTTAGCTACCTTGCCGCCGTCATGGCCTTTGCATTCCTCGTCGGCTTCCAGATCGCCAACATCTTC
ACTACTCCCTTGTCGAGCGGAATCGATACAATCTTCGTCGCCACGGGCTGGGACCCCCAAGTCTTGTACAGCGAG
CATCCCGAACTATACCAAGACATGGTCCGGGTCTACCCTCAGGTGCAGCAGGCCATCCGGGTCCGT
Transcript >Ophio5|5548
ATGAACAAGGCAGACGGCTACTCGGGCCCTGCCCAGCAGCCGCCGCCGCAACAGTACGGCCAGCAGAGCTACTAC
TACGGGGGCGACCAAGGCCATCAGGCCTACCCTCCCCAGGACGCTTACAACCATCCTCAGCCCTCTTACGCGCCC
CCGCCGCCCTATAGCTTCAACCCCCCACAGCCAAATGACGACAAATACTCGTTCGAACAAGCCTTCAAAATCGAT
GGTCCCAAGTACAATGACCTCTGGGCTGGTATTCTGTTCCTCCTCGTCTTCGCTGGCTTTGTCTTCGTCTCCGCT
TTCTCCATCCGCGGCTGGAGCACTAGAGGTGGGAGTGTCGCCGTCCCAAGCAACACCGTCGTTCTCTTCGCCTAT
ATTCTGCTTGTCGCTCTGGTCCTCTCATACGTCTACGTCTGGATGGCCCGCCTATTTCCCATACAGTTCATCTGG
GTCACCGGAATCCTCAACCTCGTCTGGACCATCGGCACCGGCATCTACTATCTGTCTATCCGGAGCTATGGCCCC
GGTATCATCTTTCTCATCATGGGTGTCTTCTTTATCTTCGCCTTCTGGACCTGGATCCCGCGCATACCCTTTTCT
GCCTTGATGCTCAAGACGTCAATCGATGTGAGCAAGCGCTATGGACACGTCTATCTCGTCAGCCTGCTTGGTGGA
CTCGTCGCCGTTGGTTTGGCCGCCTGGTACGGCGTGAGCGTCATTGCCATCTACGCCCGTTTCGGACCCGACCGC
AACTGCAACTCGCAAGCAAGTAGCTGCAGCAGCGGCACCGCCATTGGCCTCATCGCCTTTGTCACCTTTGCCATG
TACTGGGTATCCGAGTGGCTGAAGAACACGGTACACACCACCATCTCCGGCGTCTTTGGCTCATGGTACTTCTGC
CCTCACAATTTCCCCAAGGCCGCTACACGCGGCGCCTTGAAGCGTTCCCTCACCTACAGCTTTGGCTCCATCAGC
TTGGGGAGTTTGCTCGTAGCCATTGTCAACTTTCTGCGCCAGGTCTGCTCCATCGCCGGTCAGCAGGCCGCCAAT
GACGGCGGAGTCATGGACATTGCCTTTTACGTTATTTCTCTTTTAGTCGGCTGTCTCCTGATGCTCCTCGAATGG
CTGATCAGTTTCGTCAACCGGTACGCCTTTTCGTACATTGCTCTGTACGGGAAGGCCTACTTTCCCGCGGCCAAG
GACACGTGGAAGATGATCAGGGATCGCGGTGTCGACGCCCTGGTCAACGAATGTCTCATCGGACCCGTGCTTTCG
TTTGGGGCCATTTTCATAGGCGCCGCTTGCACCCTACTCGCCTTTCTCTATGTTCGACTTGTACAAGGGGACATG
GGGAGGAATGTTAGCTACCTTGCCGCCGTCATGGCCTTTGCATTCCTCGTCGGCTTCCAGATCGCCAACATCTTC
ACTACTCCCTTGTCGAGCGGAATCGATACAATCTTCGTCGCCACGGGCTGGGACCCCCAAGTCTTGTACAGCGAG
CATCCCGAACTATACCAAGACATGGTCCGGGTCTACCCTCAGGTGCAGCAGGCCATCCGGGTCCGTTGA
Gene >Ophio5|5548
ATGAACAAGGCAGACGGCTACTCGGGCCCTGCCCAGCAGCCGCCGCCGCAACAGTACGGCCAGCAGAGCTACTAC
TACGGGGGCGACCAAGGCCATCAGGCCTACCCTCCCCAGGACGCTTACAACCATCCTCAGCCCTCTTACGCGCCC
CCGCCGCCCTATAGCTTCAACCCCCCACAGCCAAATGACGACAAATACTCGTTCGAACAAGCCTTCAAAATCGAT
GGTCCCAAGTACAATGACCTCTGGGCTGGTATTCTGGTCTGCGGTTCCCCCCCCCCCCAATGTCGGCTTCCTACG
TGACTCCTTACTGACTCGTGCCCAGTTCCTCCTCGTCTTCGCTGGCTTTGTCTTCGTCTCCGCTTTCTCCATCCG
CGGCTGGAGCACTAGAGGTGGGAGTGTCGCCGTCCCAAGCAACACCGTCGTTCTCTTCGCCTATATTCTGCTTGT
CGCTCTGGTCCTCTCATACGTCTACGTCTGGATGGCCCGCCTATTTCCCATACAGTTCATCTGGGTCACCGGAAT
CCTCAACCTCGTCTGGACCATCGGCACCGGCATCTACTATCTGTCTATCCGGAGCTATGGCCCCGGTATCATCTT
TCTCATCATGGGTGTCTTCTTTATCTTCGCCTTCTGGACCTGGATCCCGCGCATACCCTTTTCTGCCTTGATGCT
CAAGACGTCAATCGATGTGAGCAAGCGCTATGGACACGTCTATCTCGTCAGCCTGCTTGGTGGACTCGTCGCCGT
TGGTTTGGCCGCCTGGTACGGCGTGAGCGTCATTGCCATCTACGCCCGTTTCGGACCCGACCGCAACTGCAACTC
GCAAGCAAGTAGCTGCAGCAGCGGCACCGCCATTGGCCTCATCGCCTTTGTCACCTTTGCCATGTACTGGGTATC
CGAGTGGCTGAAGAACACGGTACACACCACCATCTCCGGCGTCTTTGGCTCATGGTACTTCTGCCCTCACAATTT
CCCCAAGGCCGCTACACGCGGCGCCTTGAAGCGTTCCCTCACCTACAGCTTTGGCTCCATCAGCTTGGGGAGTTT
GCTCGTAGCCATTGTCAACTTTCTGCGCCAGGTCTGCTCCATCGCCGGTCAGCAGGCCGCCAATGACGGCGGAGT
CATGGACATTGCCTTTTACGTTATTTCTCTTTTAGTCGGCTGTCTCCTGATGCTCCTCGAATGTACGTCATTTTG
GCCAACTCCGTGAAAGTCAGGAGAACCTGAGACTGACTCACCCACACAGGGCTGATCAGTTTCGTCAACCGGTAC
GCCTTTTCGTACATTGCTCTGTACGGGAAGGCCTACTTTCCCGCGGCCAAGGACACGTGGAAGATGATCAGGGAT
CGCGGTGTCGACGCCCTGGTCAACGTGCGTTCCATCTTTATCCTCGGTTCTTATCAGAAAGCACACAGCTGACGT
GCTCTAGGAATGTCTCATCGGACCCGTGCTTTCGTTTGGGGCCATTTTCATAGGCGCCGCTTGCACCCTACTCGC
CTTTCTCTATGTTCGACTTGTACAAGGGGACATGGGGAGGAATGTTAGCTACCTTGCCGCCGTCATGGCCTTTGC
ATTCCTCGTCGGCTTCCAGATCGCCAACATCTTCACTACTCCCTTGTCGAGCGGAATCGATACAATCTTCGTCGC
CACGGGCTGGGACCCCCAAGTCTTGTACAGCGAGCATCCCGAACTATACCAAGACATGGTCCGGGTCTACCCTCA
GGTGCAGCAGGCCATCCGGGTCCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail