Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5545
Gene name
Locationscaffold_457:725..2900
Strand+
Gene length (bp)2175
Transcript length (bp)2124
Coding sequence length (bp)2121
Protein length (aa) 707

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03370 CBM_21 Carbohydrate/starch-binding module (family 21) 1.3E-32 310 418
PF16760 CBM53 Starch/carbohydrate-binding module (family 53) 2.2E-09 337 419

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5U2R5|PPR3C_RAT Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus GN=Ppp1r3c PE=2 SV=1 321 418 3.0E-13
sp|Q9UQK1|PPR3C_HUMAN Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens GN=PPP1R3C PE=1 SV=2 321 418 5.0E-13
sp|Q0VCR4|PPR3C_BOVIN Protein phosphatase 1 regulatory subunit 3C OS=Bos taurus GN=PPP1R3C PE=2 SV=1 321 418 5.0E-13
sp|O95685|PPR3D_HUMAN Protein phosphatase 1 regulatory subunit 3D OS=Homo sapiens GN=PPP1R3D PE=1 SV=1 306 427 3.0E-11
sp|Q99MR9|PPR3A_MOUSE Protein phosphatase 1 regulatory subunit 3A OS=Mus musculus GN=Ppp1r3a PE=1 SV=2 306 450 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5U2R5|PPR3C_RAT Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus GN=Ppp1r3c PE=2 SV=1 321 418 3.0E-13
sp|Q9UQK1|PPR3C_HUMAN Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens GN=PPP1R3C PE=1 SV=2 321 418 5.0E-13
sp|Q0VCR4|PPR3C_BOVIN Protein phosphatase 1 regulatory subunit 3C OS=Bos taurus GN=PPP1R3C PE=2 SV=1 321 418 5.0E-13
sp|O95685|PPR3D_HUMAN Protein phosphatase 1 regulatory subunit 3D OS=Homo sapiens GN=PPP1R3D PE=1 SV=1 306 427 3.0E-11
sp|Q99MR9|PPR3A_MOUSE Protein phosphatase 1 regulatory subunit 3A OS=Mus musculus GN=Ppp1r3a PE=1 SV=2 306 450 2.0E-10
sp|Q8BRJ4|PPR3E_MOUSE Protein phosphatase 1 regulatory subunit 3E OS=Mus musculus GN=Ppp1r3e PE=1 SV=2 327 418 9.0E-10
sp|Q6DDQ5|PPR3C_XENLA Protein phosphatase 1 regulatory subunit 3C OS=Xenopus laevis GN=ppp1r3c PE=2 SV=1 305 418 2.0E-09
sp|Q6GQ68|PP3BB_XENLA Protein phosphatase 1 regulatory subunit 3B-B OS=Xenopus laevis GN=ppp1r3b-b PE=2 SV=1 307 418 3.0E-09
sp|P40187|PIG2_YEAST GSY2-interacting protein PIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIG2 PE=1 SV=1 312 419 3.0E-09
sp|Q7TMB3|PPR3C_MOUSE Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus GN=Ppp1r3c PE=1 SV=1 321 418 4.0E-09
sp|P40036|GIP2_YEAST GLC7-interacting protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIP2 PE=1 SV=1 325 419 4.0E-09
sp|Q6P950|PR3CB_DANRE Protein phosphatase 1 regulatory subunit 3C-B OS=Danio rerio GN=ppp1r3cb PE=2 SV=1 306 418 5.0E-09
sp|Q00756|PPR3A_RABIT Protein phosphatase 1 regulatory subunit 3A OS=Oryctolagus cuniculus GN=PPP1R3A PE=1 SV=1 326 430 6.0E-09
sp|Q5BL87|PP3BA_XENLA Protein phosphatase 1 regulatory subunit 3B-A OS=Xenopus laevis GN=ppp1r3b-a PE=2 SV=1 307 426 1.0E-08
sp|A6QNP3|PPR3B_BOVIN Protein phosphatase 1 regulatory subunit 3B OS=Bos taurus GN=PPP1R3B PE=2 SV=1 307 418 1.0E-08
sp|Q86XI6|PPR3B_HUMAN Protein phosphatase 1 regulatory subunit 3B OS=Homo sapiens GN=PPP1R3B PE=1 SV=1 320 418 2.0E-08
sp|Q8C767|PPR3B_MOUSE Protein phosphatase 1 regulatory subunit 3B OS=Mus musculus GN=Ppp1r3b PE=1 SV=1 293 418 2.0E-08
sp|Q6IN01|PPR3B_RAT Protein phosphatase 1 regulatory subunit 3B OS=Rattus norvegicus GN=Ppp1r3b PE=1 SV=1 293 418 2.0E-08
sp|Q16821|PPR3A_HUMAN Protein phosphatase 1 regulatory subunit 3A OS=Homo sapiens GN=PPP1R3A PE=1 SV=3 326 423 3.0E-08
sp|P28006|GAC1_YEAST Serine/threonine-protein phosphatase 1 regulatory subunit GAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAC1 PE=1 SV=2 320 422 4.0E-08
sp|Q9VVY3|GBS76_DROME Glycogen-binding subunit 76A OS=Drosophila melanogaster GN=Gbs-76A PE=1 SV=1 221 416 4.0E-08
sp|Q803M0|PPR3B_DANRE Protein phosphatase 1 regulatory subunit 3B OS=Danio rerio GN=ppp1r3b PE=2 SV=1 313 418 3.0E-07
sp|Q6GL23|PPR3C_XENTR Protein phosphatase 1 regulatory subunit 3C OS=Xenopus tropicalis GN=ppp1r3c PE=2 SV=1 326 435 3.0E-07
sp|Q28E28|PPR3B_XENTR Protein phosphatase 1 regulatory subunit 3B OS=Xenopus tropicalis GN=ppp1r3b PE=2 SV=1 307 424 2.0E-06
sp|P0C7L8|PPR3E_RAT Protein phosphatase 1 regulatory subunit 3E OS=Rattus norvegicus GN=Ppp1r3e PE=2 SV=1 329 418 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:2001070 starch binding Yes
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0030246 carbohydrate binding No
GO:0030247 polysaccharide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5545
MPYTPPSQLSPPSSASTSPLVSRRSSVQSGSQPALPRSASYLNKHRRTPSIQDGCAARGIETERATAANTVANSA
ANSTSPVKPPLSSPRPDDQPPTSPVSSASCDDYQDAASQLDSYQSLRDAVSQISQPRNPSPPPAPTDPMGPTEPM
RVSLSTTALDGLAAKCSRSTGHVRSATDSNAPTISADSSLTASDEDTDEDLKFKPPMLRKKSGELVRPALRPSSH
RRPSSVPGTPIFSKAVHFDSHLEHVRHFLQVDRPLAVSAGSSPIDNHESDSEYPFPEVKSGVRSPPYEWELVTTN
FPRQVRLRNTLPVRLERVWLSADHRSLLGSVCVANMAFHKHVTCRFTFDYWKTVSEVGAEYGHEIRPYDGPATHD
RFNFSIRLSDVVNLESKTLYFCVRYSVSGQEFWDNNDSTNFQVDFKKKHLPQKGKNGLPGATSRSLNGLPRSNNR
RSNSGSSLRPMSLPPSLDAFGHEAMGADIDFDQPIHEYLGESGPTTGLRLKNKSSTNLASDNIARNLTSPSGVAF
SNRYDFGASLSAAMQAAKDSGRDKDTLYMRRNVRGAEAVKGKSQSESPLGASSSPSGTQSPNPSLPSASYEELVN
KYCFFGSKQSSPMMTDGTMRGGAYDGSKAGYEPGEAKASPPEKRTAMHHSMHLEGATSYFPPLTVTTGARALAVG
SGTPSSEMPFRGQPSDRYLWTTETQTATAILG
Coding >Ophio5|5545
ATGCCTTATACGCCCCCTTCGCAGCTATCTCCTCCGTCCTCGGCCTCGACGTCGCCCCTCGTGAGCCGTCGCTCG
TCGGTCCAATCGGGCTCTCAACCCGCCCTCCCTCGGTCCGCCTCTTACCTCAACAAGCATCGTCGCACCCCCTCG
ATACAAGATGGCTGTGCCGCCCGTGGCATCGAGACGGAGCGCGCCACGGCTGCCAACACGGTCGCAAACTCAGCC
GCCAATTCGACCAGTCCCGTGAAGCCGCCGCTGAGTTCGCCCCGACCCGACGATCAACCCCCCACGTCACCCGTC
TCGTCTGCCAGCTGCGACGACTACCAAGACGCTGCCAGCCAGCTTGACTCCTACCAGAGCCTGCGAGATGCCGTC
AGCCAGATCTCTCAGCCCCGCAACCCGTCCCCTCCCCCCGCCCCGACGGATCCGATGGGGCCAACAGAGCCCATG
AGGGTCAGCCTTAGCACGACGGCCCTCGACGGCCTGGCCGCTAAATGCTCACGCTCCACTGGCCATGTTCGATCC
GCGACGGATTCCAACGCGCCCACCATTTCCGCCGACTCGTCTCTTACGGCCTCGGACGAGGATACCGACGAGGAC
CTCAAGTTCAAGCCTCCGATGCTGCGCAAAAAGTCCGGCGAGCTCGTCCGGCCCGCACTTCGCCCATCGTCGCAT
CGCCGTCCGTCCAGCGTCCCTGGCACGCCCATCTTTTCCAAGGCTGTTCATTTTGACTCTCACCTGGAGCACGTC
CGCCACTTTCTTCAGGTTGACCGCCCCCTCGCCGTCAGTGCCGGCTCCTCGCCCATCGACAACCACGAGAGCGAC
AGTGAATATCCCTTCCCCGAGGTCAAGTCGGGTGTCCGCTCGCCCCCCTACGAGTGGGAGCTCGTCACCACAAAC
TTTCCCCGCCAAGTCCGCCTGCGTAATACGCTACCTGTCCGGCTCGAGAGGGTCTGGCTCTCGGCCGACCACAGA
TCCCTACTCGGCTCCGTCTGCGTCGCCAACATGGCCTTCCACAAGCACGTCACCTGCCGCTTCACCTTTGACTAC
TGGAAAACAGTGTCCGAGGTTGGCGCCGAGTACGGTCACGAAATTCGCCCCTACGACGGCCCCGCCACCCACGAT
CGTTTTAACTTCTCCATTAGGCTCTCCGACGTGGTGAACCTCGAGTCCAAGACGCTCTACTTTTGCGTTCGTTAC
TCTGTTAGCGGCCAGGAGTTTTGGGACAACAACGACTCCACCAACTTCCAGGTCGACTTCAAGAAAAAACACCTA
CCGCAGAAGGGCAAGAACGGGCTCCCAGGCGCCACCTCGCGCTCCCTCAACGGCCTACCTAGAAGCAACAACCGC
AGGTCAAACTCGGGCAGCTCGCTTCGGCCCATGTCCTTGCCGCCATCGCTCGACGCCTTCGGCCACGAAGCCATG
GGCGCCGACATAGATTTTGATCAGCCCATTCACGAGTACCTCGGCGAGTCTGGGCCGACGACCGGTCTGCGCCTC
AAGAACAAGTCGTCGACCAACCTTGCAAGCGACAACATCGCCCGCAACCTCACGTCGCCCAGTGGCGTTGCCTTT
TCCAACCGTTATGACTTTGGCGCCTCGCTGAGTGCCGCCATGCAGGCCGCAAAGGATTCGGGCAGAGACAAGGAC
ACGCTCTACATGAGGAGAAATGTTCGCGGAGCCGAGGCCGTCAAGGGCAAATCACAATCCGAGTCGCCGCTCGGC
GCCTCGAGTTCGCCCAGCGGGACCCAGTCGCCGAACCCGAGCCTACCGAGCGCTTCATATGAGGAGCTCGTCAAC
AAGTATTGCTTTTTTGGCTCCAAACAATCGAGTCCCATGATGACGGACGGAACAATGAGAGGCGGAGCCTACGAT
GGGTCCAAGGCTGGCTACGAGCCGGGAGAGGCAAAAGCGTCACCCCCGGAAAAGCGGACGGCGATGCACCACTCG
ATGCACCTCGAAGGCGCCACGTCATACTTTCCACCCCTCACCGTGACGACGGGTGCCAGGGCACTGGCAGTCGGC
TCGGGCACGCCTTCGAGCGAAATGCCGTTTCGCGGCCAGCCGTCTGACCGGTACCTCTGGACGACGGAGACGCAG
ACGGCGACAGCCATCTTGGGC
Transcript >Ophio5|5545
ATGCCTTATACGCCCCCTTCGCAGCTATCTCCTCCGTCCTCGGCCTCGACGTCGCCCCTCGTGAGCCGTCGCTCG
TCGGTCCAATCGGGCTCTCAACCCGCCCTCCCTCGGTCCGCCTCTTACCTCAACAAGCATCGTCGCACCCCCTCG
ATACAAGATGGCTGTGCCGCCCGTGGCATCGAGACGGAGCGCGCCACGGCTGCCAACACGGTCGCAAACTCAGCC
GCCAATTCGACCAGTCCCGTGAAGCCGCCGCTGAGTTCGCCCCGACCCGACGATCAACCCCCCACGTCACCCGTC
TCGTCTGCCAGCTGCGACGACTACCAAGACGCTGCCAGCCAGCTTGACTCCTACCAGAGCCTGCGAGATGCCGTC
AGCCAGATCTCTCAGCCCCGCAACCCGTCCCCTCCCCCCGCCCCGACGGATCCGATGGGGCCAACAGAGCCCATG
AGGGTCAGCCTTAGCACGACGGCCCTCGACGGCCTGGCCGCTAAATGCTCACGCTCCACTGGCCATGTTCGATCC
GCGACGGATTCCAACGCGCCCACCATTTCCGCCGACTCGTCTCTTACGGCCTCGGACGAGGATACCGACGAGGAC
CTCAAGTTCAAGCCTCCGATGCTGCGCAAAAAGTCCGGCGAGCTCGTCCGGCCCGCACTTCGCCCATCGTCGCAT
CGCCGTCCGTCCAGCGTCCCTGGCACGCCCATCTTTTCCAAGGCTGTTCATTTTGACTCTCACCTGGAGCACGTC
CGCCACTTTCTTCAGGTTGACCGCCCCCTCGCCGTCAGTGCCGGCTCCTCGCCCATCGACAACCACGAGAGCGAC
AGTGAATATCCCTTCCCCGAGGTCAAGTCGGGTGTCCGCTCGCCCCCCTACGAGTGGGAGCTCGTCACCACAAAC
TTTCCCCGCCAAGTCCGCCTGCGTAATACGCTACCTGTCCGGCTCGAGAGGGTCTGGCTCTCGGCCGACCACAGA
TCCCTACTCGGCTCCGTCTGCGTCGCCAACATGGCCTTCCACAAGCACGTCACCTGCCGCTTCACCTTTGACTAC
TGGAAAACAGTGTCCGAGGTTGGCGCCGAGTACGGTCACGAAATTCGCCCCTACGACGGCCCCGCCACCCACGAT
CGTTTTAACTTCTCCATTAGGCTCTCCGACGTGGTGAACCTCGAGTCCAAGACGCTCTACTTTTGCGTTCGTTAC
TCTGTTAGCGGCCAGGAGTTTTGGGACAACAACGACTCCACCAACTTCCAGGTCGACTTCAAGAAAAAACACCTA
CCGCAGAAGGGCAAGAACGGGCTCCCAGGCGCCACCTCGCGCTCCCTCAACGGCCTACCTAGAAGCAACAACCGC
AGGTCAAACTCGGGCAGCTCGCTTCGGCCCATGTCCTTGCCGCCATCGCTCGACGCCTTCGGCCACGAAGCCATG
GGCGCCGACATAGATTTTGATCAGCCCATTCACGAGTACCTCGGCGAGTCTGGGCCGACGACCGGTCTGCGCCTC
AAGAACAAGTCGTCGACCAACCTTGCAAGCGACAACATCGCCCGCAACCTCACGTCGCCCAGTGGCGTTGCCTTT
TCCAACCGTTATGACTTTGGCGCCTCGCTGAGTGCCGCCATGCAGGCCGCAAAGGATTCGGGCAGAGACAAGGAC
ACGCTCTACATGAGGAGAAATGTTCGCGGAGCCGAGGCCGTCAAGGGCAAATCACAATCCGAGTCGCCGCTCGGC
GCCTCGAGTTCGCCCAGCGGGACCCAGTCGCCGAACCCGAGCCTACCGAGCGCTTCATATGAGGAGCTCGTCAAC
AAGTATTGCTTTTTTGGCTCCAAACAATCGAGTCCCATGATGACGGACGGAACAATGAGAGGCGGAGCCTACGAT
GGGTCCAAGGCTGGCTACGAGCCGGGAGAGGCAAAAGCGTCACCCCCGGAAAAGCGGACGGCGATGCACCACTCG
ATGCACCTCGAAGGCGCCACGTCATACTTTCCACCCCTCACCGTGACGACGGGTGCCAGGGCACTGGCAGTCGGC
TCGGGCACGCCTTCGAGCGAAATGCCGTTTCGCGGCCAGCCGTCTGACCGGTACCTCTGGACGACGGAGACGCAG
ACGGCGACAGCCATCTTGGGCTAG
Gene >Ophio5|5545
ATGCCTTATACGCCCCCTTCGCAGCTATCTCCTCCGTCCTCGGCCTCGACGTCGCCCCTCGTGAGCCGTCGCTCG
TCGGTCCAATCGGGCTCTCAACCCGCCCTCCCTCGGTCCGCCTCTTACCTCAACAAGCATCGTCGCACCCCCTCG
ATACAAGATGGCTGTGCCGCCCGTGGCATCGAGACGGAGCGCGCCACGGCTGCCAACACGGTCGCAAACTCAGCC
GCCAATTCGACCAGTCCCGTGAAGCCGCCGCTGAGTTCGCCCCGACCCGACGATCAACCCCCCACGTCACCCGTC
TCGTCTGCCAGCTGCGACGACTACCAAGACGCTGCCAGCCAGCTTGACTCCTACCAGAGCCTGCGAGATGCCGTC
AGCCAGATCTCTCAGCCCCGCAACCCGTCCCCTCCCCCCGCCCCGACGGATCCGATGGGGCCAACAGAGCCCATG
AGGGTCAGCCTTAGCACGACGGCCCTCGACGGCCTGGCCGCTAAATGCTCACGCTCCACTGGCCATGTTCGATCC
GCGACGGATTCCAACGCGCCCACCATTTCCGCCGACTCGTCTCTTACGGCCTCGGACGAGGATACCGACGAGGAC
CTCAAGTTCAAGCCTCCGATGCTGCGCAAAAAGTCCGGCGAGCTCGTCCGGCCCGCACTTCGCCCATCGTCGCAT
CGCCGTCCGTCCAGCGTCCCTGGCACGCCCATCTTTTCCAAGGCTGTTCATTTTGACTCTCACCTGGAGCACGTC
CGCCACTTTCTTCAGGTTGACCGCCCCCTCGCCGTCAGTGCCGGCTCCTCGCCCATCGACAACCACGAGAGCGAC
AGTGAATATCCCTTCCCCGAGGTCAAGTCGGGTGTCCGCTCGCCCCCCTACGAGTGGGAGCTCGTCACCACAAAC
TTTCCCCGCCAAGTCCGCCTGCGTAATACGCTACCTGTCCGGCTCGAGAGGGTCTGGCTCTCGGCCGACCACAGA
TCCCTACTCGGCTCCGTCTGCGTCGCCAACATGGCCTTCCACAAGCACGTCACCTGCCGCTTCACCTTTGACTAC
TGGAAAACAGTGTCCGAGGTTGGCGCCGAGTACGGTCACGAAATTCGCCCCTACGACGGCCCCGCCACCCACGAT
CGTTTTAACTTCTCCATTAGGCTCTCCGACGTGGTGAACCTCGAGTCCAAGACGCTCTACTTTTGCGTTCGTTAC
TCTGTTAGCGGCCAGGAGTTTTGGGACAACAACGACTCCACCAACTTCCAGGTCGACTTCAAGAAAAAACACCTA
CCGCAGAAGGGCAAGAACGGGCTCCCAGGCGCCACCTCGCGCTCCCTCAACGGCCTACCTAGAAGCAACAACCGC
AGGTCAAACTCGGGCAGCTCGCTTCGGCCCATGTCCTTGCCGCCATCGCTCGACGCCTTCGGCCACGAAGCCATG
GGCGCCGACATAGATTTTGATCAGCCCATTCACGAGTACCTCGGCGAGTCTGGGCCGACGACCGGTCTGCGCCTC
AAGAACAAGTCGTCGACCAACCTTGCAAGCGACAACATCGCCCGCAACCTCACGTCGCCCAGTGGCGTTGCCTTT
TCCAACCGTTATGACTTTGGCGCCTCGCTGAGTGCCGCCATGCAGGCCGCAAAGGATTCGGGCAGAGACAAGGAC
ACGCTCTACATGAGGAGAAATGTTCGCGGAGCCGAGGCCGTCAAGGGCAAATCACAATCCGAGTCGCCGCTCGGC
GCCTCGAGTTCGCCCAGCGGGACCCAGTCGCCGAACCCGAGCCTACCGAGCGCTTCATATGAGGAGCTCGTCAAC
AAGTATTGCTTTGTACGTCCCTGACTTGCGTCGTTTTGGAGGCAGCTGCTGACTTTAGATCAGTTTGGCTCCAAA
CAATCGAGTCCCATGATGACGGACGGAACAATGAGAGGCGGAGCCTACGATGGGTCCAAGGCTGGCTACGAGCCG
GGAGAGGCAAAAGCGTCACCCCCGGAAAAGCGGACGGCGATGCACCACTCGATGCACCTCGAAGGCGCCACGTCA
TACTTTCCACCCCTCACCGTGACGACGGGTGCCAGGGCACTGGCAGTCGGCTCGGGCACGCCTTCGAGCGAAATG
CCGTTTCGCGGCCAGCCGTCTGACCGGTACCTCTGGACGACGGAGACGCAGACGGCGACAGCCATCTTGGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail