Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5534
Gene name
Locationscaffold_455:11550..13645
Strand+
Gene length (bp)2095
Transcript length (bp)1719
Coding sequence length (bp)1716
Protein length (aa) 572

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.6E-24 44 449

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 75 533 1.0E-17
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 39 359 1.0E-15
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 66 384 3.0E-14
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 72 346 4.0E-13
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 63 381 5.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 75 533 1.0E-17
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 39 359 1.0E-15
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 66 384 3.0E-14
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 72 346 4.0E-13
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 63 381 5.0E-13
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 48 365 8.0E-13
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 77 346 9.0E-13
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 48 365 1.0E-12
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 51 204 2.0E-10
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 66 204 2.0E-10
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 66 204 2.0E-09
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 77 263 5.0E-09
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 60 219 6.0E-09
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 57 309 1.0E-08
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 57 309 1.0E-08
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 77 227 1.0E-08
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 73 346 3.0E-08
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 107 205 5.0E-08
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 77 529 7.0E-08
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 63 547 2.0E-07
sp|P13924|TCR_STRAG Tetracycline resistance protein OS=Streptococcus agalactiae GN=tet PE=3 SV=1 64 373 2.0E-07
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 64 380 2.0E-07
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 64 380 2.0E-07
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 64 380 2.0E-07
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 64 380 3.0E-07
sp|Q0TAZ8|MDTL_ECOL5 Multidrug resistance protein MdtL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtL PE=3 SV=1 80 233 4.0E-07
sp|B7M562|MDTL_ECO8A Multidrug resistance protein MdtL OS=Escherichia coli O8 (strain IAI1) GN=mdtL PE=3 SV=1 80 233 6.0E-07
sp|A7ZTR5|MDTL_ECO24 Multidrug resistance protein MdtL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtL PE=3 SV=1 80 233 6.0E-07
sp|A8A6H2|MDTL_ECOHS Multidrug resistance protein MdtL OS=Escherichia coli O9:H4 (strain HS) GN=mdtL PE=3 SV=1 80 233 8.0E-07
sp|B1IX28|MDTL_ECOLC Multidrug resistance protein MdtL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtL PE=3 SV=1 80 233 8.0E-07
sp|Q31UW4|MDTL_SHIBS Multidrug resistance protein MdtL OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtL PE=3 SV=1 80 233 8.0E-07
sp|Q83PL6|MDTL_SHIFL Multidrug resistance protein MdtL OS=Shigella flexneri GN=mdtL PE=3 SV=1 80 233 8.0E-07
sp|Q3YWK3|MDTL_SHISS Multidrug resistance protein MdtL OS=Shigella sonnei (strain Ss046) GN=mdtL PE=3 SV=1 80 233 8.0E-07
sp|B2TUR5|MDTL_SHIB3 Multidrug resistance protein MdtL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtL PE=3 SV=1 80 233 8.0E-07
sp|B7UMH7|MDTL_ECO27 Multidrug resistance protein MdtL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtL PE=3 SV=1 80 233 9.0E-07
sp|Q8FBV0|MDTL_ECOL6 Multidrug resistance protein MdtL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtL PE=3 SV=1 80 233 9.0E-07
sp|B7N2F5|MDTL_ECO81 Multidrug resistance protein MdtL OS=Escherichia coli O81 (strain ED1a) GN=mdtL PE=3 SV=1 80 233 9.0E-07
sp|A1AHP3|MDTL_ECOK1 Multidrug resistance protein MdtL OS=Escherichia coli O1:K1 / APEC GN=mdtL PE=3 SV=1 80 233 1.0E-06
sp|Q8XB24|MDTL_ECO57 Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 GN=mdtL PE=3 SV=1 80 233 1.0E-06
sp|B5YXB4|MDTL_ECO5E Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtL PE=3 SV=1 80 233 1.0E-06
sp|B7NR12|MDTL_ECO7I Multidrug resistance protein MdtL OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtL PE=3 SV=1 80 240 1.0E-06
sp|B1LL36|MDTL_ECOSM Multidrug resistance protein MdtL OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtL PE=3 SV=1 80 233 1.0E-06
sp|B7MGD1|MDTL_ECO45 Multidrug resistance protein MdtL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtL PE=3 SV=1 80 233 1.0E-06
sp|Q1R4M4|MDTL_ECOUT Multidrug resistance protein MdtL OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtL PE=3 SV=1 80 233 1.0E-06
sp|Q0SYP9|MDTL_SHIF8 Multidrug resistance protein MdtL OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtL PE=3 SV=1 80 233 1.0E-06
sp|Q328Z8|MDTL_SHIDS Multidrug resistance protein MdtL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mdtL PE=3 SV=1 80 233 1.0E-06
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 77 465 2.0E-06
sp|B7NF27|MDTL_ECOLU Multidrug resistance protein MdtL OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtL PE=3 SV=1 80 240 2.0E-06
sp|B7L855|MDTL_ECO55 Multidrug resistance protein MdtL OS=Escherichia coli (strain 55989 / EAEC) GN=mdtL PE=3 SV=1 80 233 2.0E-06
sp|C4ZYY8|MDTL_ECOBW Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtL PE=3 SV=1 80 233 2.0E-06
sp|B1X9T9|MDTL_ECODH Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / DH10B) GN=mdtL PE=3 SV=1 80 233 2.0E-06
sp|P31462|MDTL_ECOLI Multidrug resistance protein MdtL OS=Escherichia coli (strain K12) GN=mdtL PE=1 SV=2 80 233 2.0E-06
sp|B6I3U3|MDTL_ECOSE Multidrug resistance protein MdtL OS=Escherichia coli (strain SE11) GN=mdtL PE=3 SV=1 80 233 2.0E-06
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 77 465 2.0E-06
sp|A9MJT5|MDTL_SALAR Multidrug resistance protein MdtL OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mdtL PE=3 SV=1 64 240 3.0E-06
sp|P36890|TCR_STAHY Tetracycline resistance protein OS=Staphylococcus hyicus GN=tet PE=3 SV=1 64 195 5.0E-06
sp|B7LK52|MDTL_ESCF3 Multidrug resistance protein MdtL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtL PE=3 SV=1 80 233 5.0E-06
sp|P32369|BAIG_CLOSV Bile acid transporter OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiG PE=3 SV=2 77 259 5.0E-06
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 34 393 9.0E-06
sp|B5BIM0|MDTL_SALPK Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtL PE=3 SV=1 64 257 1.0E-05
sp|Q5PKV6|MDTL_SALPA Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtL PE=3 SV=1 64 257 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22
2 72 94 22
3 109 131 22
4 138 160 22
5 170 192 22
6 199 221 22
7 241 263 22
8 268 290 22
9 310 332 22
10 339 358 19
11 368 390 22
12 397 419 22
13 439 461 22
14 518 540 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5534
MSSPPPAPPTERTGLVPGSDSDFGSGSGAALTLWQSLIIGIGIWLLVVIEATNMSGMAIIQDTIGHTLSAPAALF
PWFTTAYLMALSTSIPLVGRLAVAGGDANMPRRLVLPAAVVFCGGALLAALAPSAAIFIAGRVLAAVGGGAFLAL
AFVFVLALVPEPRRGIGLGLVNAAITVGVSLGAAVYGALLPLVGWRPLFWMQAPVALATALAVFLCTPASLRAGQ
KDRDSSSSSSMLQRLARIDYLGAVLLCLTVVLFLYGLAGTIQPLALGLSLVSLLALIACEYLLATDPVLPLTLLS
SRGVLLSCLAQMGLMAARWSLLFFAPIFVLAVHDAPRAAAGSVLVPTNLGFALGGILVGSLHIRRAGSFWLSCLV
ALASFAASMLGLSAIAASRTGVAPLVVLVFVNGFTTGAALNYTMAHLLHLCHPGTDYVAASLLATFRGFGGSFGT
FIGGGIFYSSLRRSLVRGYLALDGGRHLSPAHRALIPDLLGTPELVSHGGLSYEEQQVALNGYANAIGYVWRAAA
VSMLLVMVAQAATGWTAPEPPTSTDGGARGYPEHDQHALKQHRGKRS
Coding >Ophio5|5534
ATGTCGTCCCCTCCTCCGGCCCCACCGACGGAGCGCACCGGCCTCGTCCCTGGCTCCGACTCCGACTTCGGCTCC
GGCTCCGGTGCGGCCCTGACCCTCTGGCAAAGCCTCATCATCGGAATCGGCATCTGGCTCCTAGTCGTCATCGAA
GCGACAAACATGTCCGGCATGGCCATCATCCAAGACACCATCGGACACACTCTCTCGGCGCCGGCTGCATTATTC
CCCTGGTTCACGACAGCCTATCTCATGGCACTATCGACATCGATCCCTCTCGTCGGCCGCCTTGCCGTCGCCGGC
GGCGACGCCAACATGCCTCGACGGCTCGTGCTCCCTGCCGCCGTCGTCTTCTGCGGCGGTGCGCTGCTCGCGGCC
TTGGCGCCGTCGGCGGCCATCTTTATCGCTGGGCGTGTGCTCGCCGCTGTCGGTGGAGGCGCCTTCTTGGCTCTC
GCTTTCGTCTTTGTGCTGGCGCTGGTGCCGGAGCCGCGGAGGGGGATCGGCTTGGGCCTTGTGAATGCGGCCATC
ACCGTCGGCGTGTCGCTCGGCGCTGCCGTTTATGGTGCTTTGCTTCCGCTTGTTGGCTGGCGGCCTTTGTTCTGG
ATGCAGGCTCCTGTTGCCTTGGCTACCGCCCTCGCCGTCTTTCTCTGCACACCGGCTTCGCTTCGAGCTGGTCAA
AAGGATCGAGACTCGTCGTCGTCATCGTCCATGCTGCAGCGTCTAGCCCGCATCGACTATCTCGGGGCCGTGCTT
CTATGCCTCACCGTCGTCCTCTTTCTCTACGGCCTTGCCGGCACCATCCAACCCCTCGCCCTCGGCCTCTCCCTC
GTCTCCCTGTTGGCCTTGATCGCCTGCGAGTACCTCCTCGCCACCGACCCAGTCCTCCCCCTTACCCTCCTCTCG
TCCCGTGGCGTGCTCCTCTCGTGCCTAGCCCAGATGGGCCTCATGGCCGCCCGCTGGAGCCTCCTCTTCTTCGCG
CCCATCTTCGTTCTCGCCGTCCATGATGCCCCCCGTGCCGCCGCCGGATCCGTCCTTGTGCCAACCAACCTCGGC
TTCGCACTTGGCGGCATCCTCGTCGGCTCGCTGCACATCCGCCGTGCCGGCTCCTTCTGGCTGTCGTGTCTCGTC
GCCCTGGCCTCCTTTGCCGCCTCGATGCTCGGCCTCTCTGCTATCGCGGCTTCGCGCACCGGCGTGGCGCCCCTT
GTTGTCCTTGTCTTTGTTAATGGCTTCACAACCGGTGCTGCCCTCAACTACACCATGGCTCACCTGCTCCATCTC
TGCCATCCTGGCACTGACTATGTCGCTGCCAGTCTCCTCGCCACCTTTCGCGGCTTCGGCGGCAGCTTCGGCACC
TTCATCGGCGGCGGCATCTTCTATAGCTCCCTGCGCCGCAGTCTCGTCCGCGGCTACTTGGCCCTCGATGGCGGC
CGGCACCTCAGCCCGGCTCATCGTGCGCTCATCCCTGACCTGCTGGGCACGCCGGAGCTGGTGTCGCATGGCGGC
CTGTCGTACGAAGAGCAGCAAGTCGCTTTAAACGGCTATGCGAACGCCATCGGCTACGTTTGGAGGGCCGCTGCC
GTCTCGATGCTTCTCGTCATGGTGGCGCAGGCGGCGACGGGGTGGACGGCGCCCGAGCCACCAACTTCGACGGAT
GGAGGGGCTCGGGGCTATCCGGAGCATGATCAACACGCCCTGAAGCAGCATCGCGGGAAACGTTCG
Transcript >Ophio5|5534
ATGTCGTCCCCTCCTCCGGCCCCACCGACGGAGCGCACCGGCCTCGTCCCTGGCTCCGACTCCGACTTCGGCTCC
GGCTCCGGTGCGGCCCTGACCCTCTGGCAAAGCCTCATCATCGGAATCGGCATCTGGCTCCTAGTCGTCATCGAA
GCGACAAACATGTCCGGCATGGCCATCATCCAAGACACCATCGGACACACTCTCTCGGCGCCGGCTGCATTATTC
CCCTGGTTCACGACAGCCTATCTCATGGCACTATCGACATCGATCCCTCTCGTCGGCCGCCTTGCCGTCGCCGGC
GGCGACGCCAACATGCCTCGACGGCTCGTGCTCCCTGCCGCCGTCGTCTTCTGCGGCGGTGCGCTGCTCGCGGCC
TTGGCGCCGTCGGCGGCCATCTTTATCGCTGGGCGTGTGCTCGCCGCTGTCGGTGGAGGCGCCTTCTTGGCTCTC
GCTTTCGTCTTTGTGCTGGCGCTGGTGCCGGAGCCGCGGAGGGGGATCGGCTTGGGCCTTGTGAATGCGGCCATC
ACCGTCGGCGTGTCGCTCGGCGCTGCCGTTTATGGTGCTTTGCTTCCGCTTGTTGGCTGGCGGCCTTTGTTCTGG
ATGCAGGCTCCTGTTGCCTTGGCTACCGCCCTCGCCGTCTTTCTCTGCACACCGGCTTCGCTTCGAGCTGGTCAA
AAGGATCGAGACTCGTCGTCGTCATCGTCCATGCTGCAGCGTCTAGCCCGCATCGACTATCTCGGGGCCGTGCTT
CTATGCCTCACCGTCGTCCTCTTTCTCTACGGCCTTGCCGGCACCATCCAACCCCTCGCCCTCGGCCTCTCCCTC
GTCTCCCTGTTGGCCTTGATCGCCTGCGAGTACCTCCTCGCCACCGACCCAGTCCTCCCCCTTACCCTCCTCTCG
TCCCGTGGCGTGCTCCTCTCGTGCCTAGCCCAGATGGGCCTCATGGCCGCCCGCTGGAGCCTCCTCTTCTTCGCG
CCCATCTTCGTTCTCGCCGTCCATGATGCCCCCCGTGCCGCCGCCGGATCCGTCCTTGTGCCAACCAACCTCGGC
TTCGCACTTGGCGGCATCCTCGTCGGCTCGCTGCACATCCGCCGTGCCGGCTCCTTCTGGCTGTCGTGTCTCGTC
GCCCTGGCCTCCTTTGCCGCCTCGATGCTCGGCCTCTCTGCTATCGCGGCTTCGCGCACCGGCGTGGCGCCCCTT
GTTGTCCTTGTCTTTGTTAATGGCTTCACAACCGGTGCTGCCCTCAACTACACCATGGCTCACCTGCTCCATCTC
TGCCATCCTGGCACTGACTATGTCGCTGCCAGTCTCCTCGCCACCTTTCGCGGCTTCGGCGGCAGCTTCGGCACC
TTCATCGGCGGCGGCATCTTCTATAGCTCCCTGCGCCGCAGTCTCGTCCGCGGCTACTTGGCCCTCGATGGCGGC
CGGCACCTCAGCCCGGCTCATCGTGCGCTCATCCCTGACCTGCTGGGCACGCCGGAGCTGGTGTCGCATGGCGGC
CTGTCGTACGAAGAGCAGCAAGTCGCTTTAAACGGCTATGCGAACGCCATCGGCTACGTTTGGAGGGCCGCTGCC
GTCTCGATGCTTCTCGTCATGGTGGCGCAGGCGGCGACGGGGTGGACGGCGCCCGAGCCACCAACTTCGACGGAT
GGAGGGGCTCGGGGCTATCCGGAGCATGATCAACACGCCCTGAAGCAGCATCGCGGGAAACGTTCGTAA
Gene >Ophio5|5534
ATGTCGTCCCCTCCTCCGGCCCCACCGACGGAGCGCACCGGCCTCGTCCCTGGCTCCGACTCCGACTTCGGCTCC
GGCTCCGGTGCGGCCCTGACCCTCTGGCAAAGCCTCATCATCGGAATCGGCATCTGGCTCCTAGTCGTCATCGAA
GGCAAGTTTTTCTTTCTCCCATCCTCCACTGTCCTCCTCTCATGTCAGATATTGTTTTTCAGCGACAAACATGTC
CGGCATGGCCATCATCCAAGACACCATCGGACACACTCTCTCGGCGCCGGCTGCATTATTCCCCTGGTTCACGAC
AGCCTATCTCATGGCACTATCGACATCGATCCCTCTCGTCGGCCGCCTTGCCGTCGCCGGCGGCGACGCCAACAT
GCCTCGACGGCTCGTGCTCCCTGCCGCCGTCGTCTTCTGCGGCGGTGCGCTGCTCGCGGCCTTGGCGCCGTCGGC
GGCCATCTTTATCGCTGGGCGTGTGCTCGCCGCTGTCGGTGGAGGCGCCTTCTTGGCTCTCGCTTTCGTCTTTGT
GCTGGCGCTGGTGCCGGAGCCGCGGAGGGGGATCGGCTTGGGCCTTGTGAATGCGGCCATCACCGTCGGCGTGTC
GCTCGGCGCTGCCGTTTATGGTGCTTTGCTTCCGCTTGTTGGCTGGGTAGGTCGTGTCCCCCCTCTTCCGCTGCC
TTTGCTGGTTGTTGGCCTCTATATCTCATGTGTGTAAGTGCTCTCGCTTGGATAGCGGCCTTTGTTCTGGATGCA
GGCTCCTGTTGCCTTGGCTACCGCCCTCGCCGTCTTTCTCTGCACACCGGCTTCGCTTCGAGCTGGTCAAAAGGA
TCGAGACTCGTCGTCGTCATCGTCCATGCTGCAGCGTCTAGCCCGCATCGACTATCTCGGGGCCGTGCTTCTAGT
ATGTTACAGCTCCTCTCCTGTGTTGTTATTTTTTTTTTCCTCCATGTGTTTCTCAGTCCCCCCCAGACCGCCTTC
CCTCGACTCACCATCTAGTGCCTCACCGTCGTCCTCTTTCTCTACGGCCTTGCCGGCACCATCCAACCCCTCGCC
CTCGGCCTCTCCCTCGTCTCCCTGTTGGCCTTGATCGCCTGCGAGTACCTCCTCGCCACCGACCCAGTCCTCCCC
CTTACCCTCCTCTCGTCCCGTGGCGTGCTCCTCTCGTGCCTAGCCCAGATGGGCCTCATGGCCGCCCGCTGGAGC
CTCCTCTTCTTCGCGCCCATCTTCGTTCTCGCCGTCCATGATGCCCCCCGTGCCGCCGCCGGATCCGTCCTTGTG
CCAACCAACCTCGGCTTCGCACTTGGCGGCATCCTCGTCGGCTCGCTGCACATCCGCCGTGCCGGCTCCTTCTGG
CTGTCGTGTCTCGTCGCCCTGGCCTCCTTTGCCGCCTCGATGCTCGGCCTCTCTGCTATCGCGGCTTCGCGCACC
GGCGTGGCGCCCCTTGTTGTCCTTGTCTTTGTTAATGGCTTCACAACCGGTGCTGCCCTCAACTACACCATGGCT
CACCTGCTCCATCTCTGCCATCCTGGCACTGACTATGTCGCTGCCAGTCTCCTCGCCACCTTTCGCGGCTTCGGC
GGCAGCTTCGGCACCTTCATCGGCGGCGGCATCTTCTATAGCTCCCTGCGCCGCAGTCTCGTCCGCGGCTACTTG
GCCCTCGATGGCGGCCGGCACCTCAGCCCGGCTCATCGTGCGCTCATCCCTGACCTGCTGGGCACGCCGGAGCTG
GTGTCGCATGGCGGCCTGTCGTACGAAGAGCAGCAAGTCGCTTTAAACGGCTATGCGAACGCCATCGGCTACGTT
TGGAGGGCCGCTGCCGTCTCGATGCTTCTCGTCATGGTGGCGCAGGCGGCGACGGGGTGGACGGCGCCCGAGCCA
CCAACTTCGACGGATGGAGGGGCTCGGGGCTATCCGGAGCATGATCAGTGATGCGAGAAGCCAACTAGAGACAAG
CAAAAAGGGGGTAATTCATGGGTGAATTGGCTCGGGGGGAGACGTCACCGCCAGACACGCCCTGAAGCAGCATCG
CGGGAAACGGTATGACATGACAGATCTGGATTCTTTTCGTCCAACTAACACTACCCGCATGAGTTCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail