Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5530
Gene name
Locationscaffold_455:3470..6365
Strand-
Gene length (bp)2895
Transcript length (bp)2841
Coding sequence length (bp)2838
Protein length (aa) 946

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P11551|FUCP_ECOLI L-fucose-proton symporter OS=Escherichia coli (strain K12) GN=fucP PE=1 SV=3 419 820 3.0E-16
sp|P0C105|GLUP_BRUAB Glucose/galactose transporter OS=Brucella abortus biovar 1 (strain 9-941) GN=gluP PE=3 SV=1 414 705 9.0E-15
sp|Q2YIJ8|GLUP_BRUA2 Glucose/galactose transporter OS=Brucella abortus (strain 2308) GN=gluP PE=3 SV=1 414 705 9.0E-15
sp|Q8YB48|GLUP_BRUME Glucose/galactose transporter OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gluP PE=3 SV=1 414 705 4.0E-13
sp|P44776|FUCP_HAEIN L-fucose permease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fucP PE=3 SV=1 414 597 1.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 15 32 17
2 52 74 22
3 94 116 22
4 128 150 22
5 210 232 22
6 412 434 22
7 449 471 22
8 491 513 22
9 528 550 22
10 596 618 22
11 646 668 22
12 755 772 17
13 782 801 19
14 814 836 22
15 841 863 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5530
MDVAATGSVPNRGPAVFAVTTATLILATAFVGARIVCRHYVVHNVSWDDKVMAFAWLLALFLSFTIDLGAVNGLG
KHDADISHLDLDTLRRCEYVFSILYNPALMATKTSILIFYLRLAKNTLVVLRYASWATLVVVNVAGCVLTFMNIF
QCSPIGAAWMATFDRESSCIPLLTEFICAAPVNIVTDLAILALPIPVLTGMRMPSRQKTILVLTFTIGVFVAIVD
VVRIYYLQRAVSEVFMGPSTNPESRFGGQADFAWNASLSLMWSAVEVNVGMACACVPALKPLILKLLPSMIRDPD
GTWASTDSKGPGEFDVTPSRKRSSNAVPALPTLALGSIRSGGGPPVSAADFSAAPDAAYLRPPAPDPTALVACTP
STATTANPGDHGVYFGFVNLTKPKSMLKAGAAESLKYCTVVSILFFLWGLSYGLLNSLNNAVAAVNEMSFPKTLG
LTSAYFGGGYFFGPLLVGEWILRRDEHNRSKRHGKGDAENVGGFKATFIVGLCIYGIGTIMFWPSAVANSYGGFM
LSNFVVGFGLSVLEVGANAFMVLCGPPEFGETRLLLAQGVQGVGSVISGLLADKVFFRDIARDNPHDSMTLINVQ
WTYLGITLLCVILGLFFFYMPLPEVSDDELERSASQLPVASTKRSVGGLQLRTVCLVLAVFAQYAYVAAQESNNI
FFRRLLLSTASNPSLVSRRAAGGAGHLGSFDDADRPLGLAISIADFLLVGRAVFALSRFLLGYLTYLSVGRRRLP
QPRTYLAISMGLCLASALIPVVRRPSSPDLLAVCTTIFFFAEGPIWPLIFAMGLRGQGLRTKRAAAFITMGGAGP
AFFPFVMYGIINGGSTVQTAFVVVVVLQVAMMLYPVFLRLSGDARRLVDPCSAVRRVLQGDEEMSVDEAVARRHR
AQSKELDKGWLLRKASEGFSARFVMAPRKLSQQADVEHSEGGGRSP
Coding >Ophio5|5530
ATGGACGTCGCTGCCACGGGCTCGGTTCCAAATCGTGGTCCGGCCGTCTTCGCCGTCACTACTGCGACGCTCATT
CTCGCCACCGCTTTTGTCGGCGCCCGCATCGTCTGTCGTCACTATGTCGTCCACAACGTCTCCTGGGACGACAAG
GTCATGGCTTTTGCTTGGCTCCTCGCCCTGTTCCTCTCCTTCACTATCGACCTTGGTGCTGTCAATGGGCTGGGC
AAACACGATGCAGACATCTCTCATCTCGACCTTGACACACTGCGCCGTTGCGAATACGTCTTCTCCATATTATAC
AACCCGGCCCTCATGGCGACCAAGACTAGCATCTTGATCTTCTACCTGCGACTCGCCAAGAACACCCTGGTCGTC
CTGCGCTACGCCTCGTGGGCCACTCTGGTCGTCGTCAACGTCGCGGGCTGCGTTCTCACTTTCATGAACATCTTC
CAGTGCAGCCCCATTGGCGCCGCCTGGATGGCCACCTTTGACCGCGAATCGTCGTGCATCCCGCTTCTCACCGAA
TTCATCTGTGCCGCCCCGGTCAACATCGTCACCGATCTGGCCATTCTTGCCTTGCCCATTCCTGTGCTCACCGGC
ATGCGTATGCCTTCGCGGCAGAAGACGATACTCGTGCTGACCTTTACCATCGGCGTCTTTGTTGCCATCGTCGAC
GTCGTCCGTATCTACTACCTGCAGCGTGCCGTTTCCGAGGTCTTCATGGGCCCTTCCACCAATCCCGAGTCAAGG
TTCGGCGGCCAGGCCGACTTTGCGTGGAACGCTTCGCTGTCGCTCATGTGGAGCGCCGTCGAGGTCAATGTTGGC
ATGGCTTGCGCCTGCGTCCCGGCTCTCAAGCCTCTCATCCTGAAGCTTCTGCCCTCCATGATACGCGACCCAGAT
GGCACCTGGGCCTCTACCGATTCCAAAGGCCCGGGCGAATTTGACGTGACGCCGTCCCGCAAACGGTCGAGCAAT
GCCGTGCCGGCCTTGCCCACCCTGGCTCTCGGCTCCATTCGTTCGGGTGGCGGGCCGCCGGTGAGCGCCGCCGAC
TTCTCCGCGGCACCGGACGCGGCCTATCTCAGGCCCCCGGCCCCGGATCCGACGGCGCTGGTGGCTTGCACCCCT
TCCACGGCCACCACGGCCAACCCCGGCGACCATGGCGTCTACTTTGGCTTCGTCAACTTGACCAAGCCCAAGAGC
ATGCTCAAGGCCGGTGCCGCAGAGTCCCTCAAATACTGCACCGTCGTCTCCATTCTCTTTTTCCTTTGGGGCCTC
TCGTACGGCCTCCTCAATAGCCTCAACAACGCCGTCGCCGCCGTCAACGAAATGTCGTTCCCCAAGACGCTCGGC
TTGACCAGTGCCTACTTTGGCGGTGGCTACTTCTTCGGGCCCTTGCTGGTGGGAGAGTGGATTCTGCGTCGGGAC
GAGCACAATCGCTCTAAACGTCACGGAAAAGGGGATGCCGAGAACGTAGGCGGCTTCAAGGCGACCTTTATTGTT
GGCCTGTGCATCTACGGCATTGGGACCATCATGTTCTGGCCCTCGGCCGTGGCCAACTCGTACGGGGGATTCATG
CTCAGCAACTTTGTCGTCGGCTTTGGTCTGTCGGTGCTCGAGGTGGGTGCCAACGCCTTCATGGTGCTCTGCGGC
CCGCCCGAGTTCGGAGAGACGCGGCTGCTACTGGCCCAGGGCGTGCAGGGCGTCGGGAGCGTCATCAGCGGCCTC
CTGGCAGACAAGGTCTTCTTCAGGGACATTGCCCGGGACAATCCCCACGACAGCATGACGCTCATCAACGTGCAG
TGGACCTACCTCGGCATCACCTTGCTATGCGTCATTCTCGGCCTGTTCTTCTTCTACATGCCCCTGCCTGAGGTC
AGCGACGACGAGCTTGAGCGGTCGGCGAGCCAGTTGCCCGTTGCTTCGACCAAGAGGAGCGTCGGCGGCCTGCAG
CTACGGACCGTCTGCCTCGTGCTGGCCGTGTTTGCGCAGTACGCCTACGTCGCCGCCCAGGAGAGCAACAACATC
TTCTTCCGCAGGCTCCTCCTCTCGACGGCGTCAAACCCGTCACTAGTGAGCCGGCGGGCGGCGGGCGGTGCGGGT
CACCTGGGCAGTTTCGACGACGCTGACAGGCCGCTGGGTCTCGCCATCTCGATTGCCGACTTTCTCCTGGTCGGA
CGTGCCGTGTTTGCTCTGTCCCGCTTCCTGCTGGGCTACCTGACCTACCTGTCTGTCGGCCGCCGTCGGCTGCCA
CAGCCCCGGACCTACCTAGCCATCAGCATGGGCCTCTGCTTAGCGTCCGCCCTCATCCCTGTCGTGCGGCGGCCC
TCCAGCCCGGATCTGCTCGCCGTCTGCACCACCATCTTCTTCTTCGCCGAGGGCCCAATATGGCCCCTCATATTT
GCCATGGGCCTCCGAGGTCAAGGCTTGAGGACCAAGCGTGCCGCCGCCTTCATCACCATGGGGGGCGCCGGGCCT
GCATTTTTCCCATTTGTCATGTACGGCATCATCAACGGCGGCAGCACGGTGCAGACAGCCTTTGTCGTCGTCGTC
GTGTTGCAGGTCGCCATGATGCTGTACCCCGTATTCCTGAGGCTCAGCGGAGATGCGAGACGGCTCGTCGACCCG
TGTTCGGCCGTGCGACGAGTCCTTCAGGGGGACGAGGAGATGTCGGTAGATGAGGCCGTGGCTCGCAGGCACCGC
GCTCAGAGTAAGGAGTTGGATAAGGGCTGGCTTCTGCGCAAAGCTTCCGAGGGCTTCAGCGCGAGATTCGTCATG
GCTCCGCGGAAACTGTCGCAGCAGGCCGACGTGGAACACAGCGAAGGTGGTGGCCGGAGCCCA
Transcript >Ophio5|5530
ATGGACGTCGCTGCCACGGGCTCGGTTCCAAATCGTGGTCCGGCCGTCTTCGCCGTCACTACTGCGACGCTCATT
CTCGCCACCGCTTTTGTCGGCGCCCGCATCGTCTGTCGTCACTATGTCGTCCACAACGTCTCCTGGGACGACAAG
GTCATGGCTTTTGCTTGGCTCCTCGCCCTGTTCCTCTCCTTCACTATCGACCTTGGTGCTGTCAATGGGCTGGGC
AAACACGATGCAGACATCTCTCATCTCGACCTTGACACACTGCGCCGTTGCGAATACGTCTTCTCCATATTATAC
AACCCGGCCCTCATGGCGACCAAGACTAGCATCTTGATCTTCTACCTGCGACTCGCCAAGAACACCCTGGTCGTC
CTGCGCTACGCCTCGTGGGCCACTCTGGTCGTCGTCAACGTCGCGGGCTGCGTTCTCACTTTCATGAACATCTTC
CAGTGCAGCCCCATTGGCGCCGCCTGGATGGCCACCTTTGACCGCGAATCGTCGTGCATCCCGCTTCTCACCGAA
TTCATCTGTGCCGCCCCGGTCAACATCGTCACCGATCTGGCCATTCTTGCCTTGCCCATTCCTGTGCTCACCGGC
ATGCGTATGCCTTCGCGGCAGAAGACGATACTCGTGCTGACCTTTACCATCGGCGTCTTTGTTGCCATCGTCGAC
GTCGTCCGTATCTACTACCTGCAGCGTGCCGTTTCCGAGGTCTTCATGGGCCCTTCCACCAATCCCGAGTCAAGG
TTCGGCGGCCAGGCCGACTTTGCGTGGAACGCTTCGCTGTCGCTCATGTGGAGCGCCGTCGAGGTCAATGTTGGC
ATGGCTTGCGCCTGCGTCCCGGCTCTCAAGCCTCTCATCCTGAAGCTTCTGCCCTCCATGATACGCGACCCAGAT
GGCACCTGGGCCTCTACCGATTCCAAAGGCCCGGGCGAATTTGACGTGACGCCGTCCCGCAAACGGTCGAGCAAT
GCCGTGCCGGCCTTGCCCACCCTGGCTCTCGGCTCCATTCGTTCGGGTGGCGGGCCGCCGGTGAGCGCCGCCGAC
TTCTCCGCGGCACCGGACGCGGCCTATCTCAGGCCCCCGGCCCCGGATCCGACGGCGCTGGTGGCTTGCACCCCT
TCCACGGCCACCACGGCCAACCCCGGCGACCATGGCGTCTACTTTGGCTTCGTCAACTTGACCAAGCCCAAGAGC
ATGCTCAAGGCCGGTGCCGCAGAGTCCCTCAAATACTGCACCGTCGTCTCCATTCTCTTTTTCCTTTGGGGCCTC
TCGTACGGCCTCCTCAATAGCCTCAACAACGCCGTCGCCGCCGTCAACGAAATGTCGTTCCCCAAGACGCTCGGC
TTGACCAGTGCCTACTTTGGCGGTGGCTACTTCTTCGGGCCCTTGCTGGTGGGAGAGTGGATTCTGCGTCGGGAC
GAGCACAATCGCTCTAAACGTCACGGAAAAGGGGATGCCGAGAACGTAGGCGGCTTCAAGGCGACCTTTATTGTT
GGCCTGTGCATCTACGGCATTGGGACCATCATGTTCTGGCCCTCGGCCGTGGCCAACTCGTACGGGGGATTCATG
CTCAGCAACTTTGTCGTCGGCTTTGGTCTGTCGGTGCTCGAGGTGGGTGCCAACGCCTTCATGGTGCTCTGCGGC
CCGCCCGAGTTCGGAGAGACGCGGCTGCTACTGGCCCAGGGCGTGCAGGGCGTCGGGAGCGTCATCAGCGGCCTC
CTGGCAGACAAGGTCTTCTTCAGGGACATTGCCCGGGACAATCCCCACGACAGCATGACGCTCATCAACGTGCAG
TGGACCTACCTCGGCATCACCTTGCTATGCGTCATTCTCGGCCTGTTCTTCTTCTACATGCCCCTGCCTGAGGTC
AGCGACGACGAGCTTGAGCGGTCGGCGAGCCAGTTGCCCGTTGCTTCGACCAAGAGGAGCGTCGGCGGCCTGCAG
CTACGGACCGTCTGCCTCGTGCTGGCCGTGTTTGCGCAGTACGCCTACGTCGCCGCCCAGGAGAGCAACAACATC
TTCTTCCGCAGGCTCCTCCTCTCGACGGCGTCAAACCCGTCACTAGTGAGCCGGCGGGCGGCGGGCGGTGCGGGT
CACCTGGGCAGTTTCGACGACGCTGACAGGCCGCTGGGTCTCGCCATCTCGATTGCCGACTTTCTCCTGGTCGGA
CGTGCCGTGTTTGCTCTGTCCCGCTTCCTGCTGGGCTACCTGACCTACCTGTCTGTCGGCCGCCGTCGGCTGCCA
CAGCCCCGGACCTACCTAGCCATCAGCATGGGCCTCTGCTTAGCGTCCGCCCTCATCCCTGTCGTGCGGCGGCCC
TCCAGCCCGGATCTGCTCGCCGTCTGCACCACCATCTTCTTCTTCGCCGAGGGCCCAATATGGCCCCTCATATTT
GCCATGGGCCTCCGAGGTCAAGGCTTGAGGACCAAGCGTGCCGCCGCCTTCATCACCATGGGGGGCGCCGGGCCT
GCATTTTTCCCATTTGTCATGTACGGCATCATCAACGGCGGCAGCACGGTGCAGACAGCCTTTGTCGTCGTCGTC
GTGTTGCAGGTCGCCATGATGCTGTACCCCGTATTCCTGAGGCTCAGCGGAGATGCGAGACGGCTCGTCGACCCG
TGTTCGGCCGTGCGACGAGTCCTTCAGGGGGACGAGGAGATGTCGGTAGATGAGGCCGTGGCTCGCAGGCACCGC
GCTCAGAGTAAGGAGTTGGATAAGGGCTGGCTTCTGCGCAAAGCTTCCGAGGGCTTCAGCGCGAGATTCGTCATG
GCTCCGCGGAAACTGTCGCAGCAGGCCGACGTGGAACACAGCGAAGGTGGTGGCCGGAGCCCATGA
Gene >Ophio5|5530
ATGGACGTCGCTGCCACGGGCTCGGTTCCAAATCGTGGTCCGGCCGTCTTCGCCGTCACTACTGCGACGCTCATT
CTCGCCACCGCTTTTGTCGGCGCCCGCATCGTCTGTCGTCACTATGTCGTCCACAACGTCTCCTGGGACGACAAG
GTCATGGCTTTTGCTTGGCTCCTCGCCCTGTTCCTCTCCTTCACTATCGACCTTGGTGCTGTCAATGGGCTGGGC
AAACACGATGCAGACATCTCTCATCTCGACCTTGACACACTGCGCCGTTGCGAATACGTCTTCTCCATATTATAC
GTGCGTTCCCCCAGCCTGCCGATCCAGAGGTCTCGCCTTGCTGACATGGCGTAGAACCCGGCCCTCATGGCGACC
AAGACTAGCATCTTGATCTTCTACCTGCGACTCGCCAAGAACACCCTGGTCGTCCTGCGCTACGCCTCGTGGGCC
ACTCTGGTCGTCGTCAACGTCGCGGGCTGCGTTCTCACTTTCATGAACATCTTCCAGTGCAGCCCCATTGGCGCC
GCCTGGATGGCCACCTTTGACCGCGAATCGTCGTGCATCCCGCTTCTCACCGAATTCATCTGTGCCGCCCCGGTC
AACATCGTCACCGATCTGGCCATTCTTGCCTTGCCCATTCCTGTGCTCACCGGCATGCGTATGCCTTCGCGGCAG
AAGACGATACTCGTGCTGACCTTTACCATCGGCGTCTTTGTTGCCATCGTCGACGTCGTCCGTATCTACTACCTG
CAGCGTGCCGTTTCCGAGGTCTTCATGGGCCCTTCCACCAATCCCGAGTCAAGGTTCGGCGGCCAGGCCGACTTT
GCGTGGAACGCTTCGCTGTCGCTCATGTGGAGCGCCGTCGAGGTCAATGTTGGCATGGCTTGCGCCTGCGTCCCG
GCTCTCAAGCCTCTCATCCTGAAGCTTCTGCCCTCCATGATACGCGACCCAGATGGCACCTGGGCCTCTACCGAT
TCCAAAGGCCCGGGCGAATTTGACGTGACGCCGTCCCGCAAACGGTCGAGCAATGCCGTGCCGGCCTTGCCCACC
CTGGCTCTCGGCTCCATTCGTTCGGGTGGCGGGCCGCCGGTGAGCGCCGCCGACTTCTCCGCGGCACCGGACGCG
GCCTATCTCAGGCCCCCGGCCCCGGATCCGACGGCGCTGGTGGCTTGCACCCCTTCCACGGCCACCACGGCCAAC
CCCGGCGACCATGGCGTCTACTTTGGCTTCGTCAACTTGACCAAGCCCAAGAGCATGCTCAAGGCCGGTGCCGCA
GAGTCCCTCAAATACTGCACCGTCGTCTCCATTCTCTTTTTCCTTTGGGGCCTCTCGTACGGCCTCCTCAATAGC
CTCAACAACGCCGTCGCCGCCGTCAACGAAATGTCGTTCCCCAAGACGCTCGGCTTGACCAGTGCCTACTTTGGC
GGTGGCTACTTCTTCGGGCCCTTGCTGGTGGGAGAGTGGATTCTGCGTCGGGACGAGCACAATCGCTCTAAACGT
CACGGAAAAGGGGATGCCGAGAACGTAGGCGGCTTCAAGGCGACCTTTATTGTTGGCCTGTGCATCTACGGCATT
GGGACCATCATGTTCTGGCCCTCGGCCGTGGCCAACTCGTACGGGGGATTCATGCTCAGCAACTTTGTCGTCGGC
TTTGGTCTGTCGGTGCTCGAGGTGGGTGCCAACGCCTTCATGGTGCTCTGCGGCCCGCCCGAGTTCGGAGAGACG
CGGCTGCTACTGGCCCAGGGCGTGCAGGGCGTCGGGAGCGTCATCAGCGGCCTCCTGGCAGACAAGGTCTTCTTC
AGGGACATTGCCCGGGACAATCCCCACGACAGCATGACGCTCATCAACGTGCAGTGGACCTACCTCGGCATCACC
TTGCTATGCGTCATTCTCGGCCTGTTCTTCTTCTACATGCCCCTGCCTGAGGTCAGCGACGACGAGCTTGAGCGG
TCGGCGAGCCAGTTGCCCGTTGCTTCGACCAAGAGGAGCGTCGGCGGCCTGCAGCTACGGACCGTCTGCCTCGTG
CTGGCCGTGTTTGCGCAGTACGCCTACGTCGCCGCCCAGGAGAGCAACAACATCTTCTTCCGCAGGCTCCTCCTC
TCGACGGCGTCAAACCCGTCACTAGTGAGCCGGCGGGCGGCGGGCGGTGCGGGTCACCTGGGCAGTTTCGACGAC
GCTGACAGGCCGCTGGGTCTCGCCATCTCGATTGCCGACTTTCTCCTGGTCGGACGTGCCGTGTTTGCTCTGTCC
CGCTTCCTGCTGGGCTACCTGACCTACCTGTCTGTCGGCCGCCGTCGGCTGCCACAGCCCCGGACCTACCTAGCC
ATCAGCATGGGCCTCTGCTTAGCGTCCGCCCTCATCCCTGTCGTGCGGCGGCCCTCCAGCCCGGATCTGCTCGCC
GTCTGCACCACCATCTTCTTCTTCGCCGAGGGCCCAATATGGCCCCTCATATTTGCCATGGGCCTCCGAGGTCAA
GGCTTGAGGACCAAGCGTGCCGCCGCCTTCATCACCATGGGGGGCGCCGGGCCTGCATTTTTCCCATTTGTCATG
TACGGCATCATCAACGGCGGCAGCACGGTGCAGACAGCCTTTGTCGTCGTCGTCGTGTTGCAGGTCGCCATGATG
CTGTACCCCGTATTCCTGAGGCTCAGCGGAGATGCGAGACGGCTCGTCGACCCGTGTTCGGCCGTGCGACGAGTC
CTTCAGGGGGACGAGGAGATGTCGGTAGATGAGGCCGTGGCTCGCAGGCACCGCGCTCAGAGTAAGGAGTTGGAT
AAGGGCTGGCTTCTGCGCAAAGCTTCCGAGGGCTTCAGCGCGAGATTCGTCATGGCTCCGCGGAAACTGTCGCAG
CAGGCCGACGTGGAACACAGCGAAGGTGGTGGCCGGAGCCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail