Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|553
Gene name
Locationscaffold_114:34096..34628
Strand+
Gene length (bp)532
Transcript length (bp)414
Coding sequence length (bp)411
Protein length (aa) 137

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03987 Autophagy_act_C Autophagocytosis associated protein, active-site domain 1.3E-26 5 132

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0019787 ubiquitin-like protein transferase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

Domain # Start End Length
1 114 131 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|553
MISAEESDSAAIVKDMSHGDAALVTYEIHLHSSYRVPCLWFTFHNLPVDEPAFSIDTVFRRLVPEEYKSRLQGLG
AVGGISADHHPITGVPAFFIHPCLLGDAISGFQCSLDNYLMIWLGLVGGCVGLWVPREMALQ
Coding >Ophio5|553
ATGATAAGTGCAGAAGAGTCTGATTCAGCGGCCATCGTCAAAGACATGTCACATGGCGACGCTGCTCTTGTTACC
TATGAGATCCATCTCCACTCCTCCTACAGGGTCCCATGCCTGTGGTTCACCTTCCACAACCTCCCTGTGGATGAA
CCCGCCTTTAGCATCGACACAGTCTTCCGCCGCCTGGTCCCCGAGGAGTACAAAAGCAGGCTTCAAGGATTAGGC
GCCGTAGGTGGCATCTCGGCGGACCATCATCCCATCACGGGGGTTCCAGCCTTCTTCATCCATCCATGCCTGCTC
GGGGACGCCATATCGGGCTTCCAGTGCTCCCTCGACAACTACCTCATGATCTGGCTCGGACTTGTAGGGGGGTGC
GTGGGCCTCTGGGTGCCAAGAGAAATGGCCTTACAG
Transcript >Ophio5|553
ATGATAAGTGCAGAAGAGTCTGATTCAGCGGCCATCGTCAAAGACATGTCACATGGCGACGCTGCTCTTGTTACC
TATGAGATCCATCTCCACTCCTCCTACAGGGTCCCATGCCTGTGGTTCACCTTCCACAACCTCCCTGTGGATGAA
CCCGCCTTTAGCATCGACACAGTCTTCCGCCGCCTGGTCCCCGAGGAGTACAAAAGCAGGCTTCAAGGATTAGGC
GCCGTAGGTGGCATCTCGGCGGACCATCATCCCATCACGGGGGTTCCAGCCTTCTTCATCCATCCATGCCTGCTC
GGGGACGCCATATCGGGCTTCCAGTGCTCCCTCGACAACTACCTCATGATCTGGCTCGGACTTGTAGGGGGGTGC
GTGGGCCTCTGGGTGCCAAGAGAAATGGCCTTACAGTAG
Gene >Ophio5|553
ATGATAAGTGCAGAAGAGTCTGATTCAGTACGGGACGCTCTGTCGGCTCGTCTCCCTTGTCCTGACCATTCCCAG
GCGGCCATCGTCAAAGACATGTCACATGGCGACGCTGCTCTTGTTACCTATGAGATCCATCTCCACTCCTCCTAC
AGGGTCCCATGCCTGTGGTTCACCTTCCACAACCTCCCTGTGGATGAACCCGCCTTTAGCATCGACACAGTCTTC
CGCCGCCTGGTCCCCGAGGAGTACAAAAGCAGGCTTCAAGGATTAGGCGCCGTAGGTGGCATCTCGGCGGACGTA
AGTCGACGCCGCTCTCGCCAGGACACTAACGGTATCGGCCGAGTCAGCGCTGACGGTCCCGTAACAGCATCATCC
CATCACGGGGGTTCCAGCCTTCTTCATCCATCCATGCCTGCTCGGGGACGCCATATCGGGCTTCCAGTGCTCCCT
CGACAACTACCTCATGATCTGGCTCGGACTTGTAGGGGGGTGCGTGGGCCTCTGGGTGCCAAGAGAAATGGCCTT
ACAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail