Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5519
Gene name
Locationscaffold_453:16386..16939
Strand+
Gene length (bp)553
Transcript length (bp)393
Coding sequence length (bp)390
Protein length (aa) 130

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03694 Erg28 Erg28 like protein 1.5E-19 15 124

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 70 92 22
3 107 129 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5519
MPLFQSLLPSNEGYLPYYSLILSGLEFIISTRVLLNLESLRSFYNLASGQQNKPDRKGASTHASNDQITPLVGRL
FSHLTITLGSVRFYAAYHIHNGPVYDLALSTYVVGLAFMFIELYVFTSSLLNALA
Coding >Ophio5|5519
ATGCCCTTATTCCAATCCCTTCTTCCCTCCAACGAGGGCTACCTGCCGTACTATAGTCTTATTCTCTCGGGGCTG
GAGTTTATTATCTCGACGCGGGTGCTTCTGAACCTCGAAAGCTTGCGATCTTTCTATAACCTGGCATCCGGGCAA
CAAAACAAACCCGACCGAAAAGGTGCATCGACCCACGCGTCTAACGACCAGATTACGCCGCTAGTCGGCAGGTTG
TTTAGCCACTTGACTATTACTTTAGGCAGTGTCCGGTTCTATGCAGCATATCACATTCATAACGGGCCGGTCTAT
GACCTCGCGTTATCGACTTATGTTGTTGGTTTAGCCTTTATGTTTATTGAGCTTTATGTTTTTACTAGCAGTCTT
CTTAATGCGTTAGCC
Transcript >Ophio5|5519
ATGCCCTTATTCCAATCCCTTCTTCCCTCCAACGAGGGCTACCTGCCGTACTATAGTCTTATTCTCTCGGGGCTG
GAGTTTATTATCTCGACGCGGGTGCTTCTGAACCTCGAAAGCTTGCGATCTTTCTATAACCTGGCATCCGGGCAA
CAAAACAAACCCGACCGAAAAGGTGCATCGACCCACGCGTCTAACGACCAGATTACGCCGCTAGTCGGCAGGTTG
TTTAGCCACTTGACTATTACTTTAGGCAGTGTCCGGTTCTATGCAGCATATCACATTCATAACGGGCCGGTCTAT
GACCTCGCGTTATCGACTTATGTTGTTGGTTTAGCCTTTATGTTTATTGAGCTTTATGTTTTTACTAGCAGTCTT
CTTAATGCGTTAGCCTAG
Gene >Ophio5|5519
ATGCCCTTATTCCAATCCCTTCTTCCCTCCAACGAGGGCTACCTGCCGTACTATAGTCTTATTGTAAGTTGCGTC
TTGAAGTCGGTGTGGACCAGACTTAGCTTGACTCACACGCCATACAGCTCTCGGGGCTGGAGTTTATTATCTCGA
CGCGGGTGCTTCTGAACCTCGAAAGCTTGCGATCTTTCTATAACCTGGCATCCGGGCAACAAAACAAACCCGACC
GAAAAGGTGCATCGACCCACGCGTCTAACGACCAGATTACGCCGCTAGTCGGCAGGTTGTTTAGCCACTTGACTA
TTACTTTAGGCAGTGTCCGGTTCTATGCAGCATATCACATTCATAACGGGCCGGTCTATGACCTCGCGTTATCGA
CTTATGTTGTTGGTTTAGCCTTTATGTTTATTGAGCTTTATGTTTGTAAGTCGATGAGTCTTGAGGCGAACCAAG
CGGGGGCGATTCTACTTGCGTCGTGCGCTATATTGTGGATGTTTTTAGCTCGAGACTATTATATTGCATAGTTAC
TAGCAGTCTTCTTAATGCGTTAGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail