Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5516
Gene name
Locationscaffold_453:9347..10515
Strand+
Gene length (bp)1168
Transcript length (bp)1116
Coding sequence length (bp)1113
Protein length (aa) 371

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D0|LOVC_ASPTE Enoyl reductase LovC OS=Aspergillus terreus GN=lovC PE=1 SV=1 12 368 3.0E-44
sp|P54006|TOXD_COCCA Protein TOXD OS=Cochliobolus carbonum GN=TOXD PE=3 SV=1 32 294 2.0E-32
sp|P53912|YNN4_YEAST Uncharacterized protein YNL134C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL134C PE=1 SV=1 26 365 4.0E-16
sp|P54007|YL460_YEAST Uncharacterized protein YLR460C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR460C PE=1 SV=1 26 365 2.0E-14
sp|P25608|YCZ2_YEAST Uncharacterized protein YCR102C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR102C PE=3 SV=1 26 365 9.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D0|LOVC_ASPTE Enoyl reductase LovC OS=Aspergillus terreus GN=lovC PE=1 SV=1 12 368 3.0E-44
sp|P54006|TOXD_COCCA Protein TOXD OS=Cochliobolus carbonum GN=TOXD PE=3 SV=1 32 294 2.0E-32
sp|P53912|YNN4_YEAST Uncharacterized protein YNL134C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL134C PE=1 SV=1 26 365 4.0E-16
sp|P54007|YL460_YEAST Uncharacterized protein YLR460C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR460C PE=1 SV=1 26 365 2.0E-14
sp|P25608|YCZ2_YEAST Uncharacterized protein YCR102C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR102C PE=3 SV=1 26 365 9.0E-14
sp|Q9P7F4|YKK1_SCHPO Zinc-type alcohol dehydrogenase-like protein C2E1P3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P3.01 PE=3 SV=1 36 368 1.0E-08
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 24 350 1.0E-08
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 24 231 5.0E-08
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 21 350 3.0E-07
sp|O74822|YBJB_SCHPO Zinc-type alcohol dehydrogenase-like protein C337.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC337.11 PE=3 SV=1 28 190 6.0E-07
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 21 232 9.0E-07
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 24 250 1.0E-06
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 28 231 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5516
MPSSTKQTGIVQSSEAASNGLLPLAVSQSLPIPELPSAAHVLVRVLAVALNPTDHKMVANFPIPDNMVGCDFCGV
VERCHDSLESAPAHPPGTRVCGAVFPYSYNPDAPRSGAFAQWVVADSRLLLRVPRDWSHLEGAAMGGIGWGTLSL
AFYAPDALALQGRPSAPIEAAEPVLVYGAATATGTMACQLLKLSGYSPVAVASTKSAPLAVEYGAIGCAAYTSPT
CVDEIRSLAEGKPIRRALDCITSAESAAICFAAIARTGGRYACLEGLSDSWRTRQAVRTKEVMGYESLGIRIDVG
STPYSREASQEALATCAAWAREMQSLLDAATVKPHPTREVPRQWQGIIQGLTTLQKGAVRGEKLVVQIGEM
Coding >Ophio5|5516
ATGCCCTCATCAACAAAGCAAACGGGCATCGTGCAGTCTTCGGAGGCGGCCTCCAATGGGCTTTTGCCCTTGGCC
GTCTCCCAGTCGCTCCCCATCCCAGAACTGCCCTCGGCGGCCCATGTTCTCGTTCGCGTTCTCGCTGTGGCTCTG
AACCCGACCGACCATAAGATGGTGGCCAACTTCCCCATCCCGGACAACATGGTTGGGTGCGACTTCTGCGGCGTG
GTCGAGAGATGTCACGACTCCCTCGAGTCGGCGCCGGCGCACCCGCCCGGGACCAGAGTCTGTGGTGCCGTCTTC
CCTTACTCATACAACCCGGACGCCCCTCGCAGCGGTGCCTTTGCGCAATGGGTCGTTGCCGACTCTCGGCTATTG
CTGAGAGTGCCGCGAGACTGGAGCCATCTCGAGGGTGCCGCAATGGGCGGCATTGGCTGGGGCACCCTGAGCCTG
GCGTTTTATGCCCCAGACGCGCTGGCCCTTCAAGGCAGACCTTCGGCGCCCATCGAGGCCGCCGAGCCCGTCCTG
GTCTACGGGGCCGCCACTGCCACGGGAACTATGGCGTGTCAGCTGCTGAAGCTCTCCGGCTACTCACCAGTGGCC
GTCGCATCGACCAAGTCGGCGCCCCTGGCTGTCGAATATGGCGCCATCGGGTGCGCGGCCTATACTTCGCCGACG
TGCGTCGACGAGATACGGTCACTTGCCGAGGGCAAGCCCATTCGTCGAGCCCTTGACTGCATCACGAGTGCTGAG
TCTGCCGCCATCTGCTTTGCCGCCATTGCCCGGACAGGGGGCCGATATGCCTGCCTGGAGGGCTTGAGCGACTCC
TGGCGCACCCGGCAGGCCGTCCGCACCAAAGAGGTCATGGGCTACGAGAGCCTGGGCATACGCATCGACGTAGGA
TCCACCCCTTACTCCCGCGAGGCGAGTCAGGAGGCGCTGGCCACTTGCGCTGCCTGGGCCCGCGAAATGCAGTCG
TTATTAGACGCGGCAACCGTCAAGCCACACCCGACTAGGGAGGTGCCGAGACAGTGGCAGGGAATCATCCAGGGA
TTAACCACGTTGCAGAAAGGCGCCGTCCGAGGAGAAAAGCTTGTGGTACAGATTGGCGAAATG
Transcript >Ophio5|5516
ATGCCCTCATCAACAAAGCAAACGGGCATCGTGCAGTCTTCGGAGGCGGCCTCCAATGGGCTTTTGCCCTTGGCC
GTCTCCCAGTCGCTCCCCATCCCAGAACTGCCCTCGGCGGCCCATGTTCTCGTTCGCGTTCTCGCTGTGGCTCTG
AACCCGACCGACCATAAGATGGTGGCCAACTTCCCCATCCCGGACAACATGGTTGGGTGCGACTTCTGCGGCGTG
GTCGAGAGATGTCACGACTCCCTCGAGTCGGCGCCGGCGCACCCGCCCGGGACCAGAGTCTGTGGTGCCGTCTTC
CCTTACTCATACAACCCGGACGCCCCTCGCAGCGGTGCCTTTGCGCAATGGGTCGTTGCCGACTCTCGGCTATTG
CTGAGAGTGCCGCGAGACTGGAGCCATCTCGAGGGTGCCGCAATGGGCGGCATTGGCTGGGGCACCCTGAGCCTG
GCGTTTTATGCCCCAGACGCGCTGGCCCTTCAAGGCAGACCTTCGGCGCCCATCGAGGCCGCCGAGCCCGTCCTG
GTCTACGGGGCCGCCACTGCCACGGGAACTATGGCGTGTCAGCTGCTGAAGCTCTCCGGCTACTCACCAGTGGCC
GTCGCATCGACCAAGTCGGCGCCCCTGGCTGTCGAATATGGCGCCATCGGGTGCGCGGCCTATACTTCGCCGACG
TGCGTCGACGAGATACGGTCACTTGCCGAGGGCAAGCCCATTCGTCGAGCCCTTGACTGCATCACGAGTGCTGAG
TCTGCCGCCATCTGCTTTGCCGCCATTGCCCGGACAGGGGGCCGATATGCCTGCCTGGAGGGCTTGAGCGACTCC
TGGCGCACCCGGCAGGCCGTCCGCACCAAAGAGGTCATGGGCTACGAGAGCCTGGGCATACGCATCGACGTAGGA
TCCACCCCTTACTCCCGCGAGGCGAGTCAGGAGGCGCTGGCCACTTGCGCTGCCTGGGCCCGCGAAATGCAGTCG
TTATTAGACGCGGCAACCGTCAAGCCACACCCGACTAGGGAGGTGCCGAGACAGTGGCAGGGAATCATCCAGGGA
TTAACCACGTTGCAGAAAGGCGCCGTCCGAGGAGAAAAGCTTGTGGTACAGATTGGCGAAATGTGA
Gene >Ophio5|5516
ATGCCCTCATCAACAAAGCAAACGGGCATCGTGCAGTCTTCGGAGGCGGCCTCCAATGGGCTTTTGCCCTTGGCC
GTCTCCCAGTCGCTCCCCATCCCAGAACTGCCCTCGGCGGCCCATGTTCTCGTTCGCGTTCTCGCTGTGGCTCTG
AACCCGACCGACCATAAGATGGTGGCCAACTTCCCCATCCCGGACAACATGGTTGGGTGCGACTTCTGCGGCGTG
GTCGAGAGATGTCACGACTCCCTCGAGTCGGCGCCGGCGCACCCGCCCGGGACCAGAGTCTGTGGTGCCGTCTTC
CCTTACTCATACAACCCGGACGCCCCTCGCAGCGGTGCCTTTGCGCAATGGGTCGTTGCCGACTCTCGGCTATTG
CTGAGAGTGCCGCGAGACTGGAGCCATCTCGAGGGTGCCGCAATGGGCGGCATTGGCTGGGGCACCCTGAGCCTG
GCGTTTTATGCCCCAGACGCGCTGGCCCTTCAAGGCAGACCTTCGGCGCCCATCGAGGCCGCCGAGCCCGTCCTG
GTCTACGGGGCCGCCACTGCCACGGGAACTATGGCGTGTCAGCTGCTGAAGCTGTGAGTATCTTTGGTTCCCGTC
GTCTTTGTATCGGCTTGACCATCGGACCAGCTCCGGCTACTCACCAGTGGCCGTCGCATCGACCAAGTCGGCGCC
CCTGGCTGTCGAATATGGCGCCATCGGGTGCGCGGCCTATACTTCGCCGACGTGCGTCGACGAGATACGGTCACT
TGCCGAGGGCAAGCCCATTCGTCGAGCCCTTGACTGCATCACGAGTGCTGAGTCTGCCGCCATCTGCTTTGCCGC
CATTGCCCGGACAGGGGGCCGATATGCCTGCCTGGAGGGCTTGAGCGACTCCTGGCGCACCCGGCAGGCCGTCCG
CACCAAAGAGGTCATGGGCTACGAGAGCCTGGGCATACGCATCGACGTAGGATCCACCCCTTACTCCCGCGAGGC
GAGTCAGGAGGCGCTGGCCACTTGCGCTGCCTGGGCCCGCGAAATGCAGTCGTTATTAGACGCGGCAACCGTCAA
GCCACACCCGACTAGGGAGGTGCCGAGACAGTGGCAGGGAATCATCCAGGGATTAACCACGTTGCAGAAAGGCGC
CGTCCGAGGAGAAAAGCTTGTGGTACAGATTGGCGAAATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail