Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5515
Gene name
Locationscaffold_453:917..8711
Strand-
Gene length (bp)7794
Transcript length (bp)7689
Coding sequence length (bp)7686
Protein length (aa) 2562

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 1.3E-73 7 257
PF14765 PS-DH Polyketide synthase dehydratase 3.8E-46 938 1235
PF08659 KR KR domain 3.1E-42 2111 2309
PF00698 Acyl_transf_1 Acyl transferase domain 3.4E-42 548 854
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 1.6E-29 266 387
PF08242 Methyltransf_12 Methyltransferase domain 2.7E-14 1418 1518
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 5.3E-14 401 503
PF13489 Methyltransf_23 Methyltransferase domain 3.8E-10 1401 1574
PF08241 Methyltransf_11 Methyltransferase domain 2.0E-09 1418 1520
PF13649 Methyltransf_25 Methyltransferase domain 5.6E-09 1416 1516
PF13847 Methyltransf_31 Methyltransferase domain 3.1E-09 1414 1526
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 2.0E-04 1399 1532

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2 2504 0.0E+00
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 6 2523 0.0E+00
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 6 2523 0.0E+00
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 6 2488 0.0E+00
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 5 1744 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2 2504 0.0E+00
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 6 2523 0.0E+00
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 6 2523 0.0E+00
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 6 2488 0.0E+00
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 5 1744 0.0E+00
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 3 1189 4.0E-122
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 7 1183 1.0E-119
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 7 1183 1.0E-119
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 7 1183 1.0E-119
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 6 1159 2.0E-119
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 3 1160 2.0E-118
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 6 1004 3.0E-118
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 6 847 4.0E-118
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 6 1004 5.0E-118
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 8 1182 5.0E-118
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 8 1182 1.0E-117
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 8 1182 1.0E-117
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 8 1182 1.0E-117
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 8 1182 1.0E-117
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 7 850 4.0E-117
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 7 850 4.0E-117
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 7 850 4.0E-117
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 6 1004 4.0E-117
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 3 979 9.0E-115
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 3 979 9.0E-115
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 6 873 2.0E-114
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 8 1019 2.0E-114
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 7 991 2.0E-113
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1 823 6.0E-112
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 9 989 4.0E-110
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 3 823 2.0E-109
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 6 1011 5.0E-108
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 6 818 4.0E-106
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 3 818 7.0E-106
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 3 851 8.0E-106
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 6 1011 6.0E-104
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 2 989 9.0E-99
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1 1019 6.0E-97
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 3 989 2.0E-96
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 7 1018 2.0E-96
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 7 841 9.0E-96
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 7 850 1.0E-95
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 2 989 4.0E-95
sp|P96284|PKS15_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks15 PE=1 SV=2 3 436 8.0E-94
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 7 1186 1.0E-93
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 7 989 2.0E-93
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 9 989 3.0E-91
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 17 989 5.0E-91
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 9 992 5.0E-91
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 9 1017 8.0E-91
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 9 992 2.0E-88
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 7 989 9.0E-88
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 9 990 5.0E-87
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 2 990 1.0E-86
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 7 992 4.0E-86
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 9 922 9.0E-86
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 78 992 1.0E-85
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 9 989 2.0E-85
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 5 1157 4.0E-85
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 78 992 5.0E-85
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 6 983 7.0E-85
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1 992 2.0E-84
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 2 1155 5.0E-84
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 9 992 9.0E-84
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 4 514 2.0E-83
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 9 1004 2.0E-83
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 9 984 8.0E-83
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 9 989 3.0E-82
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 9 879 5.0E-79
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 9 879 5.0E-79
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 9 879 7.0E-79
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 5 989 7.0E-77
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 9 921 7.0E-76
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 9 988 1.0E-74
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 7 437 9.0E-74
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 2 988 1.0E-73
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 9 845 1.0E-73
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 9 520 2.0E-73
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 9 988 1.0E-72
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 10 988 4.0E-72
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 7 578 5.0E-72
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 9 1012 7.0E-72
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 2 988 7.0E-72
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 9 988 8.0E-72
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 3 518 1.0E-71
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 7 520 2.0E-71
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 7 519 2.0E-71
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 7 518 2.0E-71
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 9 988 4.0E-71
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 5 518 9.0E-71
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 9 988 1.0E-68
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 5 525 2.0E-67
sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 7 379 1.0E-65
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 6 444 6.0E-64
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 3 519 8.0E-64
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 2 541 1.0E-61
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 6 520 2.0E-60
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 7 441 1.0E-53
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 6 518 2.0E-53
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 5 531 9.0E-53
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 7 437 3.0E-48
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 2097 2493 2.0E-26
sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 75 436 1.0E-25
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 457 1160 2.0E-21
sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 78 437 7.0E-20
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 548 850 5.0E-18
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 540 989 6.0E-18
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 89 440 7.0E-18
sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=1 SV=3 89 437 1.0E-17
sp|P0AAI8|FABF_SHIFL 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Shigella flexneri GN=fabF PE=3 SV=2 156 437 1.0E-17
sp|P0AAI5|FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) GN=fabF PE=1 SV=2 156 437 1.0E-17
sp|P0AAI6|FABF_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabF PE=3 SV=2 156 437 1.0E-17
sp|P0AAI7|FABF_ECO57 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O157:H7 GN=fabF PE=3 SV=2 156 437 1.0E-17
sp|P57193|FABB_BUCAI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabB PE=3 SV=1 90 439 1.0E-17
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 2109 2306 2.0E-17
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 9 441 7.0E-17
sp|P0C842|CJ052_HUMAN Putative uncharacterized protein encoded by LINC00614 OS=Homo sapiens GN=LINC00614 PE=5 SV=1 33 140 8.0E-17
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1309 1798 1.0E-16
sp|P43710|FABB_HAEIN 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabB PE=3 SV=1 91 439 2.0E-16
sp|P39525|CEM1_YEAST 3-oxoacyl-[acyl-carrier-protein] synthase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEM1 PE=1 SV=1 98 440 2.0E-16
sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 174 439 4.0E-16
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 2109 2306 5.0E-16
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 2109 2306 7.0E-16
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 78 440 6.0E-15
sp|P0A953|FABB_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli (strain K12) GN=fabB PE=1 SV=1 140 436 8.0E-15
sp|P0A954|FABB_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabB PE=3 SV=1 140 436 8.0E-15
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 9 388 9.0E-15
sp|P06230|NODE_RHIME Nodulation protein E OS=Rhizobium meliloti (strain 1021) GN=nodE PE=3 SV=1 92 432 1.0E-14
sp|P23155|KAS1_STRCO Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5318 PE=3 SV=1 9 440 2.0E-14
sp|Q8KA28|FABB_BUCAP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabB PE=3 SV=1 140 439 2.0E-14
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 2103 2320 4.0E-14
sp|Q8L3X9|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana GN=KAS PE=1 SV=1 156 432 5.0E-14
sp|P16538|KAS1_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces glaucescens GN=tcmK PE=3 SV=1 1 444 6.0E-14
sp|P52410|KASC1_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana GN=KAS1 PE=2 SV=2 91 432 6.0E-14
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 2110 2322 7.0E-14
sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=1 SV=1 156 432 7.0E-14
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 2103 2320 2.0E-13
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 2103 2320 2.0E-13
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2186 2307 2.0E-13
sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 85 440 3.0E-13
sp|P41175|KAS1_STRCM Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cinnamonensis PE=3 SV=1 84 384 3.0E-13
sp|P06231|NOE4_RHIML Nodulation protein E OS=Rhizobium meliloti GN=nodE PE=3 SV=1 161 432 3.0E-13
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 2102 2314 4.0E-13
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 2079 2314 4.0E-13
sp|P9WQD7|FAB2_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasB PE=1 SV=1 22 439 4.0E-13
sp|P9WQD6|FAB2_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasB PE=3 SV=1 22 439 4.0E-13
sp|P63457|FAB2_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasB PE=3 SV=1 22 439 4.0E-13
sp|P16540|KAS1_STRVN Granaticin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces violaceoruber GN=gra-orf1 PE=3 SV=1 9 384 4.0E-13
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 2129 2314 5.0E-13
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 2102 2314 5.0E-13
sp|Q02K94|FABB_PSEAB 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fabB PE=1 SV=1 136 440 5.0E-13
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 2110 2325 6.0E-13
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 2110 2325 6.0E-13
sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 156 432 6.0E-13
sp|P23902|KASC1_HORVU 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare GN=KAS12 PE=1 SV=1 91 440 9.0E-13
sp|Q7A6F8|FABF_STAAN 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain N315) GN=fabF PE=1 SV=1 85 440 9.0E-13
sp|Q99VA6|FABF_STAAM 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabF PE=3 SV=1 85 440 9.0E-13
sp|P04684|NODE_RHILT Nodulation protein E OS=Rhizobium leguminosarum bv. trifolii GN=nodE PE=3 SV=2 134 432 1.0E-12
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 2100 2491 2.0E-12
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1382 1637 2.0E-12
sp|Q6GIA3|FABF_STAAR 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MRSA252) GN=fabF PE=3 SV=1 85 440 3.0E-12
sp|Q8NXE1|FABF_STAAW 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MW2) GN=fabF PE=1 SV=1 85 440 3.0E-12
sp|Q6GAU2|FABF_STAAS 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MSSA476) GN=fabF PE=3 SV=1 85 440 3.0E-12
sp|Q5HHA1|FABF_STAAC 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain COL) GN=fabF PE=1 SV=1 85 440 3.0E-12
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 2129 2322 4.0E-12
sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 89 432 4.0E-12
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 2129 2313 5.0E-12
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 2129 2313 5.0E-12
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 1382 1654 6.0E-12
sp|P72331|NODE_RHIS3 Nodulation protein E OS=Rhizobium sp. (strain N33) GN=nodE PE=3 SV=1 93 384 8.0E-12
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1400 1571 1.0E-11
sp|Q02059|KASA_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5087 PE=1 SV=2 9 440 1.0E-11
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1409 1574 2.0E-11
sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 156 439 2.0E-11
sp|Q5TKS0|FABF_STAAU 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) OS=Staphylococcus aureus GN=fabF PE=3 SV=1 85 432 2.0E-11
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 545 849 3.0E-11
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 545 821 3.0E-11
sp|Q89AY4|FABB_BUCBP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabB PE=3 SV=1 140 439 3.0E-11
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 544 771 3.0E-11
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 1414 1574 5.0E-11
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 2112 2319 6.0E-11
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 2112 2295 9.0E-11
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 2110 2306 1.0E-10
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 2112 2290 2.0E-10
sp|O69473|FAB2_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium leprae (strain TN) GN=kasB PE=3 SV=2 22 431 2.0E-10
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1383 1575 3.0E-10
sp|P04683|NODE_RHILV Nodulation protein E OS=Rhizobium leguminosarum bv. viciae GN=nodE PE=3 SV=2 134 432 3.0E-10
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1383 1571 4.0E-10
sp|Q9CBS7|FAB1_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium leprae (strain TN) GN=kasA PE=3 SV=1 177 439 4.0E-10
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 548 771 4.0E-10
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1379 1571 5.0E-10
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1400 1575 8.0E-10
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1400 1575 1.0E-09
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1400 1575 1.0E-09
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 2110 2313 2.0E-09
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 2181 2315 2.0E-09
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 2110 2313 2.0E-09
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 2110 2313 2.0E-09
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1383 1571 2.0E-09
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 548 794 2.0E-09
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1367 1691 3.0E-09
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1383 1571 3.0E-09
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2187 2293 3.0E-09
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1383 1575 4.0E-09
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2187 2290 6.0E-09
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 545 847 7.0E-09
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1400 1575 9.0E-09
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2177 2295 9.0E-09
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1379 1701 1.0E-08
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 2186 2293 1.0E-08
sp|P9WQD9|FAB1_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasA PE=1 SV=1 177 439 2.0E-08
sp|P9WQD8|FAB1_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasA PE=3 SV=1 177 439 2.0E-08
sp|H8ESN0|FAB1_MYCTE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=kasA PE=2 SV=2 177 439 2.0E-08
sp|P63455|FAB1_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasA PE=3 SV=1 177 439 2.0E-08
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 2103 2479 3.0E-08
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 545 797 2.0E-07
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 2214 2496 3.0E-07
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 2214 2496 3.0E-07
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 2214 2496 3.0E-07
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 2211 2312 4.0E-07
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 2211 2312 4.0E-07
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 2211 2312 4.0E-07
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 2211 2312 4.0E-07
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 2211 2312 4.0E-07
sp|P40804|PKSF_BACSU Polyketide biosynthesis malonyl-ACP decarboxylase PksF OS=Bacillus subtilis (strain 168) GN=pksF PE=1 SV=3 166 441 5.0E-07
sp|A9AFC0|UBIE_BURM1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ubiE PE=3 SV=1 1412 1577 5.0E-07
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 2112 2310 6.0E-07
sp|Q39D13|UBIE_BURL3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ubiE PE=3 SV=1 1412 1577 7.0E-07
sp|P43678|KAS1_STRRM Oxytetracycline polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces rimosus PE=3 SV=2 9 384 7.0E-07
sp|A4JHS6|UBIE_BURVG Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ubiE PE=3 SV=1 1412 1577 8.0E-07
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 548 808 8.0E-07
sp|A7Z4X8|BAEC_BACMF Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeC PE=1 SV=1 545 802 8.0E-07
sp|B2JCU8|UBIE_BURP8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ubiE PE=3 SV=1 1412 1560 9.0E-07
sp|Q8Y278|UBIE_RALSO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ralstonia solanacearum (strain GMI1000) GN=ubiE PE=3 SV=1 1412 1589 9.0E-07
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1379 1627 1.0E-06
sp|B2UFG8|UBIE_RALPJ Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ralstonia pickettii (strain 12J) GN=ubiE PE=3 SV=1 1412 1589 1.0E-06
sp|B2AH07|UBIE_CUPTR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=ubiE PE=3 SV=1 1412 1589 1.0E-06
sp|Q2T139|UBIE_BURTA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ubiE PE=3 SV=1 1412 1560 1.0E-06
sp|Q63XA0|UBIE_BURPS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain K96243) GN=ubiE PE=3 SV=1 1412 1560 1.0E-06
sp|A3N5U8|UBIE_BURP6 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 668) GN=ubiE PE=3 SV=1 1412 1560 1.0E-06
sp|Q3JVZ6|UBIE_BURP1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 1710b) GN=ubiE PE=3 SV=1 1412 1560 1.0E-06
sp|A3NRJ4|UBIE_BURP0 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 1106a) GN=ubiE PE=3 SV=1 1412 1560 1.0E-06
sp|A1V753|UBIE_BURMS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain SAVP1) GN=ubiE PE=3 SV=1 1412 1560 1.0E-06
sp|Q62MP4|UBIE_BURMA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain ATCC 23344) GN=ubiE PE=3 SV=1 1412 1560 1.0E-06
sp|A2S8L1|UBIE_BURM9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain NCTC 10229) GN=ubiE PE=3 SV=1 1412 1560 1.0E-06
sp|A3MNT8|UBIE_BURM7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain NCTC 10247) GN=ubiE PE=3 SV=1 1412 1560 1.0E-06
sp|A0KAF5|UBIE_BURCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain HI2424) GN=ubiE PE=3 SV=1 1412 1577 4.0E-06
sp|Q1BTN4|UBIE_BURCA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain AU 1054) GN=ubiE PE=3 SV=1 1412 1577 4.0E-06
sp|B4EBC4|UBIE_BURCJ Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=ubiE PE=3 SV=1 1412 1577 4.0E-06
sp|B1JYJ6|UBIE_BURCC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain MC0-3) GN=ubiE PE=3 SV=1 1412 1577 4.0E-06
sp|Q0BBY4|UBIE_BURCM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ubiE PE=3 SV=1 1412 1576 4.0E-06
sp|B1YWF9|UBIE_BURA4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia ambifaria (strain MC40-6) GN=ubiE PE=3 SV=1 1412 1576 4.0E-06
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 2104 2307 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 16.90 9.13 24.67
CcL In ants, during behavior modification 1.30 0.43 2.17
CcD In ants, recently dead 2.39 0.98 3.80

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.049795 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5515
MIQKANEPIAIVGSACRFPGDASSPSKLWDILLDPKDLQREISDDRFSAEGFYHPNGAHHGHSNVRKAYLLNEDL
SLFDASFFGIKPIEARAMDPQQRFLLETTYEALESAGMPIADLRGSDTAVYVGVMSNDYGTMLLRDIQNTPTYCA
TGVGQSILSNRLSYFFDWHGPSVTIDTACSSSLVAIHMAVQTLRGGESRTAVACGSNLILGPENFVMESKLQMLS
PDGRSRMWDQGANGYARGDGVASVVLKKLSDAMADGDDIECIIRETSVGQDGATAAGLTVPSSTAQAGLIRSTYA
KAGLDMLKRHHRPQYFEAHGTGTPVGDPAEARAIYNTFSGSHQGGHPLYVGSIKSVLGHAEGAAGIAAVLKASLA
LQKGYIPPNLLFERLSDRVEPFYKNMEIRKAAMPWPDVEGGTRRASVNSFGFGGTNAHAILEHYEKTPSPRSEVA
VNSTPFVFSAYSEHSLRAMLSEYAAYLGSSGKGIDVKDLAWTLRERRSTLPCRVAFSASSLDHLRLKMESKLRQE
NTNIGITALPVTSGSGGPKILGVFTGQGAQYARMGAELMEKSELARNMIEDLESHLAQLPGEDAPTWSLRAEMAA
NDSSSRVNEAALSQPLCTAVQILLVHLLQQAGVFFDAIVGHSSGEIAAAYAAGCLTAREAICIAYYRGLHLQLVS
SPNGVGIRGAMAAVGSSMQDVTSLCEDELFSGRVVVAASNSPSSVTISGDEDAVAELQLVLDDENKFNRRLRVDR
AYHSGHMLPCYEPYVASLRRCALAPRKPRDGCVFISSVYNRPFDLDMGLEAVYWAENMTRPVLFYQALRGALAGC
PCSLALEVGAHAALRSPANETIRAALGKEMPYQGVLSRGVAADEALSDCLGFLWCYMDKTRISLDKYARAAAGSE
RSYNLVKGLPTYRWRHDVKHWHESRSCRNTRLRRRRVHPLLGDVSPDCASRHMSWHNVLRVSEMEWLSGHRVQGQ
TVYPAAAHLAAALEAARVLAEGAGRELRLLDLREFTIHEAIVFDGDEVGVEVLVSMADIARDPQLQGIRANFTCS
AALGPETQQDLTLVASGRVEMVLGEASRSLLPPRHLSLPHAIEVEPDRFYESITHLGYNFSDRFRSLLAPRRRHG
KATCQVRMRPSEDADDSLMLHPAELDAALQAIILAYSHPYDRQLHSLYVPASFRHVRINPALCGAAQPLSIDSII
VSRDSGQRSITGDASIYSGECQHAAVQIQCASFAPLGQSAVEDSKVFSKVDWVRDRPDGVEAARDIALTARHHDT
ARVLERISTFFLRMFDRDVPPDDASRSEFPTSWYLKYARHMNTVVESGRHRFATKEWLRDSLEDILEASRPFSDT
PDVQIMLLVGEQMPRVLRGETTILEHFRQDDILDRYYASGFGWEESTRWVGQVVKQIVDRYPTMNIFEAGAGTGA
ATKAIFREIGQTYLSYTYTDISSVFLEAGSSAFSQHADGMVFQLFDAEKDPLAQGFAQAAYDLIVAFYVIHATSH
LERCLCNLRKLLKPGGFLVVGEAQEVQHDLARSGFIFGTLPGWWLGADSGRNLSPQVSLHEWDRLLRSTGFSGVD
ATPPEDFRETFGVCHFVSQAIDDQVNFLREPLVSACRPPPLDKVVIIGGQSPRSSHLSQGLEATFRAGFSTQVHA
FKTLVDVDFSVVDAHSAVVSLVELDRPIFEDMTAETFEALKTMYALPKTLLWVTSGRLGDEPFANMTVGFGRTAR
HETPDLHIQQLDIADPHRTSPQTIAELLLRLKATVSSSNYTGNAEPEIVIDEKQRQFVSRLRPIRELNDRYNSAR
RSIKHEVEAAKSCIEIRPTPKGYVMQALPRYASSTPKGFVSLEVTHTTISALPTPFGPKFLALGVDATAGVSYMA
LIPSLASVVNVSSKSLVYCQTSGPLDGVELLATTGAHLISKAALDPLSRGQTLLAHNATSLVARALAMQAAVKGV
SVVFSTDASERQVPDSWHNLAPYLSQVELDEFLLFNPSAFLGMSKDEVQRSANETGLASSLPPYCHTMTTKTVFS
SIGCESSPCSDVSLKDMLCVALNYAQEHLLGKIPRPLKASILRLDSFSEGAHPEDPLSIVDWTAATSLSVPVCRL
DVKPMFKGADSTYWVVGMTGGMGISLCDWMISKGARNIVLTSRNPDVAPEWIEYHRKRKANVVVIAWLDPAPDPH
THWPGGKLTDLYTCSDATDEAALRAVHQRICETLPPIVGVANGPMVLRDTSIRNMSYEELMDVVRPKVKSSIYLD
RIFHDDDLDFFILISSLNSIVGNIGQANYAAGNSFLGGLAAHRRKRGLRAAAVNFGAITGAGFIERESSRGIDLF
VKIFHLMRLSEEDWYQSVCETIDACRLDSPHGPELTTGLQDISIDSSDVPYWAFNPKFLYFTIQKKAASTGKDVG
NTTASIRELVRVCQSQAELSEVIGHALADQLRKRLQVTIGDEEILAARSNEIGIDSLVSADIRVWFLKNLQTSIP
ILKIIGNDTMASLVQLAVDGMPAELVPQISGADGVDRTALAEASGQQDKVNGANGSEQAEVNGANGSQQAGVNGS
QGAKGFTWKDQA
Coding >Ophio5|5515
ATGATCCAGAAAGCGAATGAGCCAATTGCCATCGTGGGAAGCGCGTGTCGCTTTCCCGGAGATGCCAGCTCGCCG
TCCAAGCTGTGGGATATCCTCCTAGACCCGAAGGACCTCCAACGCGAGATCTCCGACGACCGCTTTAGCGCCGAA
GGATTCTACCATCCCAATGGAGCCCATCACGGCCACAGCAACGTCAGAAAAGCGTACCTCCTGAACGAGGACCTG
AGTCTCTTTGACGCCTCTTTCTTCGGGATCAAGCCCATCGAGGCCAGAGCCATGGATCCTCAGCAGCGGTTTCTG
CTCGAAACCACCTATGAGGCTCTAGAGTCAGCCGGGATGCCCATTGCAGACCTCAGAGGCAGCGACACAGCCGTG
TATGTCGGCGTCATGTCAAACGACTACGGCACCATGCTCCTCCGCGACATTCAAAACACGCCCACGTACTGCGCC
ACTGGCGTCGGGCAGAGCATTCTATCGAATCGACTGTCGTACTTTTTCGACTGGCACGGCCCGTCTGTCACCATT
GACACGGCATGCTCGTCCAGTCTTGTGGCCATCCACATGGCAGTTCAGACCCTCCGGGGCGGCGAGTCCAGGACG
GCAGTGGCGTGCGGCTCCAACCTAATCCTCGGCCCGGAAAACTTCGTCATGGAGAGTAAACTACAGATGTTATCC
CCTGATGGCCGAAGCCGGATGTGGGACCAGGGGGCCAACGGCTACGCGCGTGGCGATGGCGTCGCCTCGGTGGTT
CTCAAGAAGCTTAGCGATGCCATGGCCGACGGCGACGACATCGAGTGCATCATCAGGGAGACGTCGGTGGGCCAG
GATGGCGCGACGGCGGCCGGTCTCACCGTTCCTAGCTCGACCGCCCAGGCGGGCCTGATTCGCAGCACGTACGCC
AAGGCGGGCCTCGACATGCTCAAGCGGCATCATCGTCCCCAGTACTTTGAGGCCCACGGCACCGGGACGCCGGTG
GGAGATCCCGCAGAGGCCAGGGCAATATACAATACCTTTTCGGGGTCCCACCAGGGCGGTCACCCGCTTTACGTC
GGGTCCATCAAGTCTGTCCTTGGACACGCCGAGGGCGCCGCGGGTATCGCGGCGGTGCTCAAGGCGTCGCTCGCC
CTGCAAAAAGGCTACATACCGCCGAACCTCCTCTTCGAACGCCTCAGCGACCGAGTTGAGCCCTTCTACAAGAAT
ATGGAGATCCGCAAGGCCGCCATGCCGTGGCCGGACGTCGAGGGAGGCACAAGAAGGGCGAGCGTTAATAGCTTT
GGCTTCGGAGGGACCAACGCACACGCCATTCTCGAGCATTATGAAAAGACGCCAAGTCCTCGCTCAGAAGTGGCC
GTGAACTCGACCCCGTTCGTGTTTTCCGCTTACTCGGAGCACTCCCTGCGGGCCATGCTCTCCGAGTACGCAGCC
TACCTCGGTAGCAGCGGTAAAGGAATCGACGTCAAGGATCTTGCGTGGACCTTACGGGAGCGTCGATCTACCTTG
CCATGTCGGGTAGCCTTCTCGGCGTCGTCGTTGGACCATCTCAGGCTTAAGATGGAGAGCAAGCTTCGGCAAGAA
AACACCAATATTGGCATCACGGCGCTACCCGTCACATCTGGAAGCGGGGGACCCAAGATCCTGGGGGTATTCACA
GGCCAAGGCGCACAGTACGCTCGCATGGGGGCCGAGCTGATGGAGAAGTCGGAACTGGCACGGAATATGATTGAG
GACTTAGAGTCGCACCTCGCCCAGCTCCCGGGCGAGGACGCTCCTACATGGTCTCTCCGGGCCGAGATGGCGGCC
AACGACTCGTCGAGCCGGGTGAACGAGGCCGCCTTGTCCCAGCCGCTGTGCACGGCAGTCCAGATCCTTCTTGTC
CACCTCCTGCAGCAGGCTGGCGTGTTCTTTGACGCTATTGTCGGGCACTCGTCAGGCGAGATTGCTGCCGCCTAC
GCGGCCGGCTGCCTCACGGCTCGCGAAGCCATCTGTATCGCCTACTACCGGGGCTTACACCTTCAGCTCGTATCA
AGCCCCAACGGCGTCGGCATTCGAGGTGCCATGGCGGCGGTCGGAAGCTCCATGCAAGACGTAACGTCGCTCTGC
GAGGACGAGCTCTTCTCGGGCCGCGTTGTTGTCGCGGCCAGCAACTCGCCATCGAGCGTGACCATCTCGGGAGAT
GAGGACGCCGTGGCCGAGCTCCAGCTGGTTCTGGACGACGAGAACAAGTTCAACCGGCGCCTAAGAGTCGATCGG
GCCTACCACTCGGGCCACATGCTTCCCTGCTACGAGCCCTATGTGGCCTCCCTGCGGCGCTGCGCCCTTGCTCCG
CGAAAGCCGCGGGACGGCTGTGTCTTCATCTCGAGCGTCTACAATCGCCCCTTTGACCTGGACATGGGGCTTGAA
GCCGTCTACTGGGCCGAAAATATGACCCGGCCCGTCTTATTCTACCAAGCACTCAGAGGCGCCCTGGCCGGCTGT
CCCTGCAGCCTGGCGCTCGAGGTCGGGGCCCATGCCGCCCTGAGGTCGCCCGCGAACGAGACGATCCGGGCCGCG
CTGGGCAAGGAGATGCCCTATCAGGGCGTGCTTTCGAGGGGAGTGGCGGCCGATGAGGCCTTGTCGGACTGCCTG
GGGTTCCTGTGGTGCTACATGGACAAGACACGCATCAGTCTGGACAAGTACGCAAGAGCTGCGGCAGGTTCCGAG
CGCAGCTATAACCTCGTCAAGGGCCTCCCCACGTACCGGTGGCGGCACGACGTCAAGCACTGGCACGAGTCACGG
AGCTGTCGCAACACGCGCTTGAGGCGGCGACGTGTCCACCCGCTGCTCGGGGACGTATCGCCCGACTGCGCTTCT
CGTCACATGAGCTGGCACAACGTCTTGCGGGTGAGCGAGATGGAGTGGCTTTCTGGCCATCGGGTTCAGGGGCAA
ACCGTCTATCCGGCCGCCGCGCACCTGGCAGCGGCTCTGGAGGCTGCTCGTGTGCTGGCCGAGGGAGCAGGGAGG
GAATTGCGCCTCTTGGATCTCCGGGAGTTCACGATACACGAGGCCATCGTCTTTGATGGCGACGAGGTAGGCGTC
GAGGTGCTCGTATCCATGGCAGACATCGCCAGAGACCCGCAGCTGCAAGGCATTCGCGCCAACTTCACTTGCTCG
GCAGCCTTGGGGCCCGAGACGCAACAGGACCTGACACTGGTGGCCAGCGGCCGTGTCGAGATGGTCCTTGGCGAA
GCCTCGCGGTCCCTGCTGCCGCCACGTCACCTGTCACTGCCCCATGCCATAGAGGTAGAGCCCGATCGGTTCTAC
GAATCCATCACGCACCTGGGCTACAACTTCAGCGACCGCTTCCGCTCCTTGCTGGCTCCCCGGAGGAGGCACGGC
AAGGCGACTTGCCAGGTTCGGATGCGACCGTCCGAAGACGCCGACGACTCGTTGATGCTCCATCCCGCAGAGCTC
GATGCCGCTCTGCAGGCCATCATACTTGCGTACAGCCATCCCTATGACAGACAACTTCACTCGCTCTACGTTCCC
GCCTCCTTTCGACACGTCAGGATCAACCCGGCCTTATGCGGCGCCGCCCAGCCTCTGTCCATTGACTCCATCATC
GTGTCCCGGGACTCGGGTCAGAGAAGCATCACAGGAGACGCGAGCATATACTCCGGCGAGTGCCAGCACGCGGCC
GTCCAGATACAGTGCGCCAGCTTCGCGCCTCTTGGGCAGTCCGCCGTCGAGGACAGCAAGGTCTTCTCCAAGGTT
GATTGGGTCCGCGACCGTCCGGACGGCGTGGAAGCCGCGCGCGACATTGCGCTGACGGCACGGCATCACGACACG
GCCCGTGTGCTGGAGAGAATATCAACATTCTTCCTGAGGATGTTTGACCGGGACGTGCCCCCTGATGACGCCTCG
AGATCCGAGTTCCCGACCAGCTGGTACCTCAAGTACGCCCGGCATATGAACACGGTCGTCGAGAGCGGCCGGCAC
AGGTTTGCGACCAAGGAGTGGCTGCGTGACAGCCTGGAAGACATTCTGGAAGCCAGCCGCCCCTTTTCCGACACC
CCCGATGTCCAGATCATGCTTCTCGTTGGGGAGCAGATGCCGCGCGTCCTCAGGGGCGAGACGACGATTCTTGAG
CATTTCCGTCAAGACGATATCCTCGACCGGTACTACGCCAGCGGGTTTGGGTGGGAAGAGTCGACCCGCTGGGTC
GGTCAGGTGGTGAAACAGATTGTTGATCGATACCCGACCATGAACATCTTCGAGGCCGGTGCCGGCACCGGTGCT
GCCACCAAGGCCATTTTCCGCGAAATCGGCCAAACCTACCTGTCGTACACCTATACCGACATTTCTTCCGTCTTC
CTCGAAGCCGGCTCCTCGGCTTTCTCGCAGCACGCCGACGGCATGGTCTTCCAGCTCTTCGACGCGGAAAAGGAC
CCCCTGGCTCAAGGCTTTGCCCAGGCTGCCTACGACTTGATCGTCGCCTTTTACGTCATCCACGCGACAAGTCAT
CTGGAACGATGCCTGTGCAACCTCCGCAAGCTGCTGAAGCCAGGCGGGTTTCTTGTCGTTGGCGAGGCCCAGGAG
GTGCAGCATGACCTTGCCAGATCCGGCTTCATCTTTGGGACCTTGCCCGGTTGGTGGCTCGGGGCCGACTCAGGG
CGGAACCTGTCGCCCCAGGTGTCTCTTCATGAGTGGGATCGACTGCTCAGGTCGACCGGCTTCTCCGGCGTCGAT
GCAACTCCTCCGGAGGACTTTAGAGAAACCTTTGGCGTCTGCCACTTCGTCTCCCAGGCCATCGATGATCAAGTA
AATTTCCTCCGAGAGCCCCTTGTCTCGGCGTGCCGTCCACCCCCCCTCGACAAGGTGGTCATTATTGGTGGTCAG
TCGCCTCGCAGCTCGCACCTGTCTCAAGGACTCGAGGCCACTTTCAGAGCGGGCTTTTCAACACAAGTCCATGCC
TTCAAGACCCTTGTCGACGTCGACTTCTCCGTGGTGGACGCCCATTCTGCAGTCGTCAGTCTGGTGGAGCTCGAC
CGGCCCATCTTCGAGGACATGACGGCAGAGACCTTCGAGGCACTCAAGACCATGTACGCCTTGCCCAAGACGCTC
CTTTGGGTGACCAGCGGTCGGCTTGGGGACGAGCCCTTTGCCAACATGACGGTTGGCTTCGGCCGAACGGCCAGG
CACGAGACGCCCGACCTGCACATCCAGCAGCTGGACATTGCAGACCCCCATCGAACCAGCCCCCAGACTATTGCC
GAGCTTCTCCTCCGCCTGAAGGCAACCGTCTCTAGTAGCAATTACACCGGAAACGCCGAGCCCGAAATAGTCATT
GATGAGAAGCAGCGCCAGTTTGTATCGCGACTCCGTCCCATACGCGAGCTCAACGACCGCTACAATTCGGCCCGT
CGGTCCATCAAGCACGAGGTCGAGGCGGCCAAATCATGTATAGAAATCAGGCCCACTCCCAAGGGATACGTGATG
CAGGCGCTGCCTAGATATGCGTCGTCGACGCCCAAGGGTTTCGTTTCGCTGGAGGTCACGCACACAACAATCTCC
GCTCTGCCGACTCCTTTTGGGCCCAAGTTTCTAGCGCTCGGGGTGGATGCAACGGCTGGAGTTTCGTACATGGCT
CTTATTCCATCGCTGGCCTCGGTTGTCAACGTTTCGTCCAAGTCCCTTGTCTACTGCCAGACATCGGGCCCCCTC
GACGGGGTCGAGCTGCTCGCCACGACCGGGGCTCATCTGATCTCCAAGGCCGCTCTCGATCCGCTCAGTCGCGGG
CAGACACTTCTAGCACATAACGCCACGAGCCTAGTAGCCCGGGCCCTCGCTATGCAGGCGGCTGTCAAGGGCGTG
TCGGTCGTGTTCTCGACAGACGCCTCTGAGCGCCAAGTACCCGACTCGTGGCACAATCTTGCCCCTTACTTGAGC
CAAGTTGAGCTCGATGAGTTCCTTCTCTTCAACCCCTCGGCGTTCCTGGGCATGTCCAAGGATGAGGTCCAGAGG
TCCGCCAACGAGACCGGCCTGGCATCGAGCCTCCCCCCCTATTGCCATACCATGACGACTAAGACGGTGTTTTCC
TCGATTGGATGCGAAAGTAGCCCGTGCAGCGACGTTTCCCTGAAGGATATGCTATGCGTGGCCCTCAACTACGCA
CAGGAGCATCTCCTGGGAAAGATTCCCCGTCCATTGAAGGCGTCAATCCTTCGCCTGGACAGTTTCTCCGAAGGA
GCACACCCTGAGGACCCGCTGTCCATCGTCGACTGGACAGCCGCCACTTCGCTCTCAGTTCCTGTCTGCAGACTT
GATGTGAAGCCCATGTTCAAGGGGGCTGACAGCACTTACTGGGTCGTAGGAATGACTGGTGGGATGGGCATTTCG
CTCTGTGACTGGATGATTAGCAAGGGTGCTAGAAACATTGTCCTTACCAGCAGGAATCCAGACGTGGCTCCCGAA
TGGATCGAATATCACAGAAAGAGAAAGGCCAACGTCGTTGTCATCGCATGGTTAGACCCAGCCCCCGACCCCCAC
ACCCACTGGCCAGGTGGCAAGCTAACGGATCTATACACTTGTAGCGATGCCACCGACGAGGCCGCCCTGAGGGCA
GTCCACCAGAGGATTTGCGAAACTCTCCCGCCCATTGTTGGCGTTGCCAATGGGCCCATGGTGTTGCGTGATACT
TCGATTCGCAACATGTCGTATGAAGAGCTGATGGACGTCGTCAGACCCAAGGTCAAATCGAGCATCTACCTCGAC
CGCATCTTCCATGACGACGACCTCGACTTTTTCATCCTCATCTCTTCCCTCAACTCCATTGTCGGCAACATCGGC
CAGGCCAATTACGCAGCCGGGAACTCATTCCTGGGCGGGCTCGCGGCCCACCGCCGGAAGCGCGGGCTCCGGGCC
GCTGCCGTCAACTTTGGGGCCATCACCGGCGCCGGCTTCATTGAACGCGAGTCTAGCCGCGGAATCGACCTGTTT
GTCAAGATTTTCCACCTCATGCGCCTCTCCGAGGAAGACTGGTATCAGTCGGTCTGCGAGACCATTGACGCGTGC
CGCCTAGACTCCCCGCATGGGCCGGAGCTCACGACTGGTCTTCAGGATATTTCCATCGACTCCTCTGACGTTCCT
TACTGGGCTTTCAATCCCAAGTTCCTATACTTCACCATTCAGAAAAAGGCAGCGAGCACAGGCAAAGACGTGGGA
AATACGACTGCGTCGATTCGAGAGCTCGTTCGGGTGTGCCAATCTCAGGCGGAGCTATCCGAGGTCATCGGACAC
GCTCTGGCCGATCAGTTGCGCAAGAGGCTACAGGTGACCATTGGCGACGAAGAGATTCTTGCCGCGCGCAGCAAC
GAGATCGGCATCGATTCCCTCGTGTCCGCCGATATCCGCGTATGGTTCCTCAAGAACCTGCAGACCAGCATACCC
ATCCTGAAGATCATCGGGAACGACACCATGGCGAGCCTGGTGCAATTGGCCGTCGACGGTATGCCGGCCGAGCTG
GTGCCGCAAATATCTGGCGCCGACGGGGTGGACAGGACCGCGTTGGCCGAGGCGAGCGGACAGCAGGATAAGGTG
AACGGAGCCAATGGGTCTGAGCAGGCCGAGGTGAACGGGGCCAATGGGTCTCAGCAGGCCGGGGTAAACGGAAGC
CAAGGTGCGAAAGGGTTCACTTGGAAGGATCAAGCA
Transcript >Ophio5|5515
ATGATCCAGAAAGCGAATGAGCCAATTGCCATCGTGGGAAGCGCGTGTCGCTTTCCCGGAGATGCCAGCTCGCCG
TCCAAGCTGTGGGATATCCTCCTAGACCCGAAGGACCTCCAACGCGAGATCTCCGACGACCGCTTTAGCGCCGAA
GGATTCTACCATCCCAATGGAGCCCATCACGGCCACAGCAACGTCAGAAAAGCGTACCTCCTGAACGAGGACCTG
AGTCTCTTTGACGCCTCTTTCTTCGGGATCAAGCCCATCGAGGCCAGAGCCATGGATCCTCAGCAGCGGTTTCTG
CTCGAAACCACCTATGAGGCTCTAGAGTCAGCCGGGATGCCCATTGCAGACCTCAGAGGCAGCGACACAGCCGTG
TATGTCGGCGTCATGTCAAACGACTACGGCACCATGCTCCTCCGCGACATTCAAAACACGCCCACGTACTGCGCC
ACTGGCGTCGGGCAGAGCATTCTATCGAATCGACTGTCGTACTTTTTCGACTGGCACGGCCCGTCTGTCACCATT
GACACGGCATGCTCGTCCAGTCTTGTGGCCATCCACATGGCAGTTCAGACCCTCCGGGGCGGCGAGTCCAGGACG
GCAGTGGCGTGCGGCTCCAACCTAATCCTCGGCCCGGAAAACTTCGTCATGGAGAGTAAACTACAGATGTTATCC
CCTGATGGCCGAAGCCGGATGTGGGACCAGGGGGCCAACGGCTACGCGCGTGGCGATGGCGTCGCCTCGGTGGTT
CTCAAGAAGCTTAGCGATGCCATGGCCGACGGCGACGACATCGAGTGCATCATCAGGGAGACGTCGGTGGGCCAG
GATGGCGCGACGGCGGCCGGTCTCACCGTTCCTAGCTCGACCGCCCAGGCGGGCCTGATTCGCAGCACGTACGCC
AAGGCGGGCCTCGACATGCTCAAGCGGCATCATCGTCCCCAGTACTTTGAGGCCCACGGCACCGGGACGCCGGTG
GGAGATCCCGCAGAGGCCAGGGCAATATACAATACCTTTTCGGGGTCCCACCAGGGCGGTCACCCGCTTTACGTC
GGGTCCATCAAGTCTGTCCTTGGACACGCCGAGGGCGCCGCGGGTATCGCGGCGGTGCTCAAGGCGTCGCTCGCC
CTGCAAAAAGGCTACATACCGCCGAACCTCCTCTTCGAACGCCTCAGCGACCGAGTTGAGCCCTTCTACAAGAAT
ATGGAGATCCGCAAGGCCGCCATGCCGTGGCCGGACGTCGAGGGAGGCACAAGAAGGGCGAGCGTTAATAGCTTT
GGCTTCGGAGGGACCAACGCACACGCCATTCTCGAGCATTATGAAAAGACGCCAAGTCCTCGCTCAGAAGTGGCC
GTGAACTCGACCCCGTTCGTGTTTTCCGCTTACTCGGAGCACTCCCTGCGGGCCATGCTCTCCGAGTACGCAGCC
TACCTCGGTAGCAGCGGTAAAGGAATCGACGTCAAGGATCTTGCGTGGACCTTACGGGAGCGTCGATCTACCTTG
CCATGTCGGGTAGCCTTCTCGGCGTCGTCGTTGGACCATCTCAGGCTTAAGATGGAGAGCAAGCTTCGGCAAGAA
AACACCAATATTGGCATCACGGCGCTACCCGTCACATCTGGAAGCGGGGGACCCAAGATCCTGGGGGTATTCACA
GGCCAAGGCGCACAGTACGCTCGCATGGGGGCCGAGCTGATGGAGAAGTCGGAACTGGCACGGAATATGATTGAG
GACTTAGAGTCGCACCTCGCCCAGCTCCCGGGCGAGGACGCTCCTACATGGTCTCTCCGGGCCGAGATGGCGGCC
AACGACTCGTCGAGCCGGGTGAACGAGGCCGCCTTGTCCCAGCCGCTGTGCACGGCAGTCCAGATCCTTCTTGTC
CACCTCCTGCAGCAGGCTGGCGTGTTCTTTGACGCTATTGTCGGGCACTCGTCAGGCGAGATTGCTGCCGCCTAC
GCGGCCGGCTGCCTCACGGCTCGCGAAGCCATCTGTATCGCCTACTACCGGGGCTTACACCTTCAGCTCGTATCA
AGCCCCAACGGCGTCGGCATTCGAGGTGCCATGGCGGCGGTCGGAAGCTCCATGCAAGACGTAACGTCGCTCTGC
GAGGACGAGCTCTTCTCGGGCCGCGTTGTTGTCGCGGCCAGCAACTCGCCATCGAGCGTGACCATCTCGGGAGAT
GAGGACGCCGTGGCCGAGCTCCAGCTGGTTCTGGACGACGAGAACAAGTTCAACCGGCGCCTAAGAGTCGATCGG
GCCTACCACTCGGGCCACATGCTTCCCTGCTACGAGCCCTATGTGGCCTCCCTGCGGCGCTGCGCCCTTGCTCCG
CGAAAGCCGCGGGACGGCTGTGTCTTCATCTCGAGCGTCTACAATCGCCCCTTTGACCTGGACATGGGGCTTGAA
GCCGTCTACTGGGCCGAAAATATGACCCGGCCCGTCTTATTCTACCAAGCACTCAGAGGCGCCCTGGCCGGCTGT
CCCTGCAGCCTGGCGCTCGAGGTCGGGGCCCATGCCGCCCTGAGGTCGCCCGCGAACGAGACGATCCGGGCCGCG
CTGGGCAAGGAGATGCCCTATCAGGGCGTGCTTTCGAGGGGAGTGGCGGCCGATGAGGCCTTGTCGGACTGCCTG
GGGTTCCTGTGGTGCTACATGGACAAGACACGCATCAGTCTGGACAAGTACGCAAGAGCTGCGGCAGGTTCCGAG
CGCAGCTATAACCTCGTCAAGGGCCTCCCCACGTACCGGTGGCGGCACGACGTCAAGCACTGGCACGAGTCACGG
AGCTGTCGCAACACGCGCTTGAGGCGGCGACGTGTCCACCCGCTGCTCGGGGACGTATCGCCCGACTGCGCTTCT
CGTCACATGAGCTGGCACAACGTCTTGCGGGTGAGCGAGATGGAGTGGCTTTCTGGCCATCGGGTTCAGGGGCAA
ACCGTCTATCCGGCCGCCGCGCACCTGGCAGCGGCTCTGGAGGCTGCTCGTGTGCTGGCCGAGGGAGCAGGGAGG
GAATTGCGCCTCTTGGATCTCCGGGAGTTCACGATACACGAGGCCATCGTCTTTGATGGCGACGAGGTAGGCGTC
GAGGTGCTCGTATCCATGGCAGACATCGCCAGAGACCCGCAGCTGCAAGGCATTCGCGCCAACTTCACTTGCTCG
GCAGCCTTGGGGCCCGAGACGCAACAGGACCTGACACTGGTGGCCAGCGGCCGTGTCGAGATGGTCCTTGGCGAA
GCCTCGCGGTCCCTGCTGCCGCCACGTCACCTGTCACTGCCCCATGCCATAGAGGTAGAGCCCGATCGGTTCTAC
GAATCCATCACGCACCTGGGCTACAACTTCAGCGACCGCTTCCGCTCCTTGCTGGCTCCCCGGAGGAGGCACGGC
AAGGCGACTTGCCAGGTTCGGATGCGACCGTCCGAAGACGCCGACGACTCGTTGATGCTCCATCCCGCAGAGCTC
GATGCCGCTCTGCAGGCCATCATACTTGCGTACAGCCATCCCTATGACAGACAACTTCACTCGCTCTACGTTCCC
GCCTCCTTTCGACACGTCAGGATCAACCCGGCCTTATGCGGCGCCGCCCAGCCTCTGTCCATTGACTCCATCATC
GTGTCCCGGGACTCGGGTCAGAGAAGCATCACAGGAGACGCGAGCATATACTCCGGCGAGTGCCAGCACGCGGCC
GTCCAGATACAGTGCGCCAGCTTCGCGCCTCTTGGGCAGTCCGCCGTCGAGGACAGCAAGGTCTTCTCCAAGGTT
GATTGGGTCCGCGACCGTCCGGACGGCGTGGAAGCCGCGCGCGACATTGCGCTGACGGCACGGCATCACGACACG
GCCCGTGTGCTGGAGAGAATATCAACATTCTTCCTGAGGATGTTTGACCGGGACGTGCCCCCTGATGACGCCTCG
AGATCCGAGTTCCCGACCAGCTGGTACCTCAAGTACGCCCGGCATATGAACACGGTCGTCGAGAGCGGCCGGCAC
AGGTTTGCGACCAAGGAGTGGCTGCGTGACAGCCTGGAAGACATTCTGGAAGCCAGCCGCCCCTTTTCCGACACC
CCCGATGTCCAGATCATGCTTCTCGTTGGGGAGCAGATGCCGCGCGTCCTCAGGGGCGAGACGACGATTCTTGAG
CATTTCCGTCAAGACGATATCCTCGACCGGTACTACGCCAGCGGGTTTGGGTGGGAAGAGTCGACCCGCTGGGTC
GGTCAGGTGGTGAAACAGATTGTTGATCGATACCCGACCATGAACATCTTCGAGGCCGGTGCCGGCACCGGTGCT
GCCACCAAGGCCATTTTCCGCGAAATCGGCCAAACCTACCTGTCGTACACCTATACCGACATTTCTTCCGTCTTC
CTCGAAGCCGGCTCCTCGGCTTTCTCGCAGCACGCCGACGGCATGGTCTTCCAGCTCTTCGACGCGGAAAAGGAC
CCCCTGGCTCAAGGCTTTGCCCAGGCTGCCTACGACTTGATCGTCGCCTTTTACGTCATCCACGCGACAAGTCAT
CTGGAACGATGCCTGTGCAACCTCCGCAAGCTGCTGAAGCCAGGCGGGTTTCTTGTCGTTGGCGAGGCCCAGGAG
GTGCAGCATGACCTTGCCAGATCCGGCTTCATCTTTGGGACCTTGCCCGGTTGGTGGCTCGGGGCCGACTCAGGG
CGGAACCTGTCGCCCCAGGTGTCTCTTCATGAGTGGGATCGACTGCTCAGGTCGACCGGCTTCTCCGGCGTCGAT
GCAACTCCTCCGGAGGACTTTAGAGAAACCTTTGGCGTCTGCCACTTCGTCTCCCAGGCCATCGATGATCAAGTA
AATTTCCTCCGAGAGCCCCTTGTCTCGGCGTGCCGTCCACCCCCCCTCGACAAGGTGGTCATTATTGGTGGTCAG
TCGCCTCGCAGCTCGCACCTGTCTCAAGGACTCGAGGCCACTTTCAGAGCGGGCTTTTCAACACAAGTCCATGCC
TTCAAGACCCTTGTCGACGTCGACTTCTCCGTGGTGGACGCCCATTCTGCAGTCGTCAGTCTGGTGGAGCTCGAC
CGGCCCATCTTCGAGGACATGACGGCAGAGACCTTCGAGGCACTCAAGACCATGTACGCCTTGCCCAAGACGCTC
CTTTGGGTGACCAGCGGTCGGCTTGGGGACGAGCCCTTTGCCAACATGACGGTTGGCTTCGGCCGAACGGCCAGG
CACGAGACGCCCGACCTGCACATCCAGCAGCTGGACATTGCAGACCCCCATCGAACCAGCCCCCAGACTATTGCC
GAGCTTCTCCTCCGCCTGAAGGCAACCGTCTCTAGTAGCAATTACACCGGAAACGCCGAGCCCGAAATAGTCATT
GATGAGAAGCAGCGCCAGTTTGTATCGCGACTCCGTCCCATACGCGAGCTCAACGACCGCTACAATTCGGCCCGT
CGGTCCATCAAGCACGAGGTCGAGGCGGCCAAATCATGTATAGAAATCAGGCCCACTCCCAAGGGATACGTGATG
CAGGCGCTGCCTAGATATGCGTCGTCGACGCCCAAGGGTTTCGTTTCGCTGGAGGTCACGCACACAACAATCTCC
GCTCTGCCGACTCCTTTTGGGCCCAAGTTTCTAGCGCTCGGGGTGGATGCAACGGCTGGAGTTTCGTACATGGCT
CTTATTCCATCGCTGGCCTCGGTTGTCAACGTTTCGTCCAAGTCCCTTGTCTACTGCCAGACATCGGGCCCCCTC
GACGGGGTCGAGCTGCTCGCCACGACCGGGGCTCATCTGATCTCCAAGGCCGCTCTCGATCCGCTCAGTCGCGGG
CAGACACTTCTAGCACATAACGCCACGAGCCTAGTAGCCCGGGCCCTCGCTATGCAGGCGGCTGTCAAGGGCGTG
TCGGTCGTGTTCTCGACAGACGCCTCTGAGCGCCAAGTACCCGACTCGTGGCACAATCTTGCCCCTTACTTGAGC
CAAGTTGAGCTCGATGAGTTCCTTCTCTTCAACCCCTCGGCGTTCCTGGGCATGTCCAAGGATGAGGTCCAGAGG
TCCGCCAACGAGACCGGCCTGGCATCGAGCCTCCCCCCCTATTGCCATACCATGACGACTAAGACGGTGTTTTCC
TCGATTGGATGCGAAAGTAGCCCGTGCAGCGACGTTTCCCTGAAGGATATGCTATGCGTGGCCCTCAACTACGCA
CAGGAGCATCTCCTGGGAAAGATTCCCCGTCCATTGAAGGCGTCAATCCTTCGCCTGGACAGTTTCTCCGAAGGA
GCACACCCTGAGGACCCGCTGTCCATCGTCGACTGGACAGCCGCCACTTCGCTCTCAGTTCCTGTCTGCAGACTT
GATGTGAAGCCCATGTTCAAGGGGGCTGACAGCACTTACTGGGTCGTAGGAATGACTGGTGGGATGGGCATTTCG
CTCTGTGACTGGATGATTAGCAAGGGTGCTAGAAACATTGTCCTTACCAGCAGGAATCCAGACGTGGCTCCCGAA
TGGATCGAATATCACAGAAAGAGAAAGGCCAACGTCGTTGTCATCGCATGGTTAGACCCAGCCCCCGACCCCCAC
ACCCACTGGCCAGGTGGCAAGCTAACGGATCTATACACTTGTAGCGATGCCACCGACGAGGCCGCCCTGAGGGCA
GTCCACCAGAGGATTTGCGAAACTCTCCCGCCCATTGTTGGCGTTGCCAATGGGCCCATGGTGTTGCGTGATACT
TCGATTCGCAACATGTCGTATGAAGAGCTGATGGACGTCGTCAGACCCAAGGTCAAATCGAGCATCTACCTCGAC
CGCATCTTCCATGACGACGACCTCGACTTTTTCATCCTCATCTCTTCCCTCAACTCCATTGTCGGCAACATCGGC
CAGGCCAATTACGCAGCCGGGAACTCATTCCTGGGCGGGCTCGCGGCCCACCGCCGGAAGCGCGGGCTCCGGGCC
GCTGCCGTCAACTTTGGGGCCATCACCGGCGCCGGCTTCATTGAACGCGAGTCTAGCCGCGGAATCGACCTGTTT
GTCAAGATTTTCCACCTCATGCGCCTCTCCGAGGAAGACTGGTATCAGTCGGTCTGCGAGACCATTGACGCGTGC
CGCCTAGACTCCCCGCATGGGCCGGAGCTCACGACTGGTCTTCAGGATATTTCCATCGACTCCTCTGACGTTCCT
TACTGGGCTTTCAATCCCAAGTTCCTATACTTCACCATTCAGAAAAAGGCAGCGAGCACAGGCAAAGACGTGGGA
AATACGACTGCGTCGATTCGAGAGCTCGTTCGGGTGTGCCAATCTCAGGCGGAGCTATCCGAGGTCATCGGACAC
GCTCTGGCCGATCAGTTGCGCAAGAGGCTACAGGTGACCATTGGCGACGAAGAGATTCTTGCCGCGCGCAGCAAC
GAGATCGGCATCGATTCCCTCGTGTCCGCCGATATCCGCGTATGGTTCCTCAAGAACCTGCAGACCAGCATACCC
ATCCTGAAGATCATCGGGAACGACACCATGGCGAGCCTGGTGCAATTGGCCGTCGACGGTATGCCGGCCGAGCTG
GTGCCGCAAATATCTGGCGCCGACGGGGTGGACAGGACCGCGTTGGCCGAGGCGAGCGGACAGCAGGATAAGGTG
AACGGAGCCAATGGGTCTGAGCAGGCCGAGGTGAACGGGGCCAATGGGTCTCAGCAGGCCGGGGTAAACGGAAGC
CAAGGTGCGAAAGGGTTCACTTGGAAGGATCAAGCATGA
Gene >Ophio5|5515
ATGATCCAGAAAGCGAATGAGCCAATTGCCATCGTGGGAAGCGCGTGTCGCTTTCCCGGAGATGCCAGCTCGCCG
TCCAAGCTGTGGGATATCCTCCTAGACCCGAAGGACCTCCAACGCGAGATCTCCGACGACCGCTTTAGCGCCGAA
GGATTCTACCATCCCAATGGAGCCCATCACGGCCACAGCAACGTCAGAAAAGCGTACCTCCTGAACGAGGACCTG
AGTCTCTTTGACGCCTCTTTCTTCGGGATCAAGCCCATCGAGGCCAGAGCCATGGATCCTCAGCAGCGGTTTCTG
CTCGAAACCACCTATGAGGCTCTAGAGTCAGCCGGGATGCCCATTGCAGACCTCAGAGGCAGCGACACAGCCGTG
TATGTCGGCGTCATGTCAAACGACTACGGCACCATGCTCCTCCGCGACATTCAAAACACGCCCACGTACTGCGCC
ACTGGCGTCGGGCAGAGCATTCTATCGAATCGACTGTCGTACTTTTTCGACTGGCACGGCCCGTCTGTCACCATT
GACACGGCATGCTCGTCCAGTCTTGTGGCCATCCACATGGCAGTTCAGACCCTCCGGGGCGGCGAGTCCAGGACG
GCAGTGGCGTGCGGCTCCAACCTAATCCTCGGCCCGGAAAACTTCGTCATGGAGAGTAAACTACAGATGTTATCC
CCTGATGGCCGAAGCCGGATGTGGGACCAGGGGGCCAACGGCTACGCGCGTGGCGATGGCGTCGCCTCGGTGGTT
CTCAAGAAGCTTAGCGATGCCATGGCCGACGGCGACGACATCGAGTGCATCATCAGGGAGACGTCGGTGGGCCAG
GATGGCGCGACGGCGGCCGGTCTCACCGTTCCTAGCTCGACCGCCCAGGCGGGCCTGATTCGCAGCACGTACGCC
AAGGCGGGCCTCGACATGCTCAAGCGGCATCATCGTCCCCAGTACTTTGAGGCCCACGGCACCGGGACGCCGGTG
GGAGATCCCGCAGAGGCCAGGGCAATATACAATACCTTTTCGGGGTCCCACCAGGGCGGTCACCCGCTTTACGTC
GGGTCCATCAAGTCTGTCCTTGGACACGCCGAGGGCGCCGCGGGTATCGCGGCGGTGCTCAAGGCGTCGCTCGCC
CTGCAAAAAGGCTACATACCGCCGAACCTCCTCTTCGAACGCCTCAGCGACCGAGTTGAGCCCTTCTACAAGAAT
ATGGAGATCCGCAAGGCCGCCATGCCGTGGCCGGACGTCGAGGGAGGCACAAGAAGGGCGAGCGTTAATAGCTTT
GGCTTCGGAGGGACCAACGCACACGCCATTCTCGAGCATTATGAAAAGACGCCAAGTCCTCGCTCAGAAGTGGCC
GTGAACTCGACCCCGTTCGTGTTTTCCGCTTACTCGGAGCACTCCCTGCGGGCCATGCTCTCCGAGTACGCAGCC
TACCTCGGTAGCAGCGGTAAAGGAATCGACGTCAAGGATCTTGCGTGGACCTTACGGGAGCGTCGATCTACCTTG
CCATGTCGGGTAGCCTTCTCGGCGTCGTCGTTGGACCATCTCAGGCTTAAGATGGAGAGCAAGCTTCGGCAAGAA
AACACCAATATTGGCATCACGGCGCTACCCGTCACATCTGGAAGCGGGGGACCCAAGATCCTGGGGGTATTCACA
GGCCAAGGCGCACAGTACGCTCGCATGGGGGCCGAGCTGATGGAGAAGTCGGAACTGGCACGGAATATGATTGAG
GACTTAGAGTCGCACCTCGCCCAGCTCCCGGGCGAGGACGCTCCTACATGGTCTCTCCGGGCCGAGATGGCGGCC
AACGACTCGTCGAGCCGGGTGAACGAGGCCGCCTTGTCCCAGCCGCTGTGCACGGCAGTCCAGATCCTTCTTGTC
CACCTCCTGCAGCAGGCTGGCGTGTTCTTTGACGCTATTGTCGGGCACTCGTCAGGCGAGATTGCTGCCGCCTAC
GCGGCCGGCTGCCTCACGGCTCGCGAAGCCATCTGTATCGCCTACTACCGGGGCTTACACCTTCAGCTCGTATCA
AGCCCCAACGGCGTCGGCATTCGAGGTGCCATGGCGGCGGTCGGAAGCTCCATGCAAGACGTAACGTCGCTCTGC
GAGGACGAGCTCTTCTCGGGCCGCGTTGTTGTCGCGGCCAGCAACTCGCCATCGAGCGTGACCATCTCGGGAGAT
GAGGACGCCGTGGCCGAGCTCCAGCTGGTTCTGGACGACGAGAACAAGTTCAACCGGCGCCTAAGAGTCGATCGG
GCCTACCACTCGGGCCACATGCTTCCCTGCTACGAGCCCTATGTGGCCTCCCTGCGGCGCTGCGCCCTTGCTCCG
CGAAAGCCGCGGGACGGCTGTGTCTTCATCTCGAGCGTCTACAATCGCCCCTTTGACCTGGACATGGGGCTTGAA
GCCGTCTACTGGGCCGAAAATATGACCCGGCCCGTCTTATTCTACCAAGCACTCAGAGGCGCCCTGGCCGGCTGT
CCCTGCAGCCTGGCGCTCGAGGTCGGGGCCCATGCCGCCCTGAGGTCGCCCGCGAACGAGACGATCCGGGCCGCG
CTGGGCAAGGAGATGCCCTATCAGGGCGTGCTTTCGAGGGGAGTGGCGGCCGATGAGGCCTTGTCGGACTGCCTG
GGGTTCCTGTGGTGCTACATGGACAAGACACGCATCAGTCTGGACAAGTACGCAAGAGCTGCGGCAGGTTCCGAG
CGCAGCTATAACCTCGTCAAGGGCCTCCCCACGTACCGGTGGCGGCACGACGTCAAGCACTGGCACGAGTCACGG
AGCTGTCGCAACACGCGCTTGAGGCGGCGACGTGTCCACCCGCTGCTCGGGGACGTATCGCCCGACTGCGCTTCT
CGTCACATGAGCTGGCACAACGTCTTGCGGGTGAGCGAGATGGAGTGGCTTTCTGGCCATCGGGTTCAGGGGCAA
ACCGTCTATCCGGCCGCCGCGCACCTGGCAGCGGCTCTGGAGGCTGCTCGTGTGCTGGCCGAGGGAGCAGGGAGG
GAATTGCGCCTCTTGGATCTCCGGGAGTTCACGATACACGAGGCCATCGTCTTTGATGGCGACGAGGTAGGCGTC
GAGGTGCTCGTATCCATGGCAGACATCGCCAGAGACCCGCAGCTGCAAGGCATTCGCGCCAACTTCACTTGCTCG
GCAGCCTTGGGGCCCGAGACGCAACAGGACCTGACACTGGTGGCCAGCGGCCGTGTCGAGATGGTCCTTGGCGAA
GCCTCGCGGTCCCTGCTGCCGCCACGTCACCTGTCACTGCCCCATGCCATAGAGGTAGAGCCCGATCGGTTCTAC
GAATCCATCACGCACCTGGGCTACAACTTCAGCGACCGCTTCCGCTCCTTGCTGGCTCCCCGGAGGAGGCACGGC
AAGGCGACTTGCCAGGTTCGGATGCGACCGTCCGAAGACGCCGACGACTCGTTGATGCTCCATCCCGCAGAGCTC
GATGCCGCTCTGCAGGCCATCATACTTGCGTACAGCCATCCCTATGACAGACAACTTCACTCGCTCTACGTTCCC
GCCTCCTTTCGACACGTCAGGATCAACCCGGCCTTATGCGGCGCCGCCCAGCCTCTGTCCATTGACTCCATCATC
GTGTCCCGGGACTCGGGTCAGAGAAGCATCACAGGAGACGCGAGCATATACTCCGGCGAGTGCCAGCACGCGGCC
GTCCAGATACAGTGCGCCAGCTTCGCGCCTCTTGGGCAGTCCGCCGTCGAGGACAGCAAGGTCTTCTCCAAGGTT
GATTGGGTCCGCGACCGTCCGGACGGCGTGGAAGCCGCGCGCGACATTGCGCTGACGGCACGGCATCACGACACG
GCCCGTGTGCTGGAGAGAATATCAACATTCTTCCTGAGGATGTTTGACCGGGACGTGCCCCCTGATGACGCCTCG
AGATCCGAGTTCCCGACCAGCTGGTACCTCAAGTACGCCCGGCATATGAACACGGTCGTCGAGAGCGGCCGGCAC
AGGTTTGCGACCAAGGAGTGGCTGCGTGACAGCCTGGAAGACATTCTGGAAGCCAGCCGCCCCTTTTCCGACACC
CCCGATGTCCAGATCATGCTTCTCGTTGGGGAGCAGATGCCGCGCGTCCTCAGGGGCGAGACGACGATTCTTGAG
CATTTCCGTCAAGACGATATCCTCGACCGGTACTACGCCAGCGGGTTTGGGTGGGAAGAGTCGACCCGCTGGGTC
GGTCAGGTGGTGAAACAGATTGTTGATCGATACCCGACCATGAACATCTTCGAGGCCGGTGAGTAGCTCGTCACG
TCCGCTTCGCCCCGTTCCGCACTGACTTCTTGGCCAGGTGCCGGCACCGGTGCTGCCACCAAGGCCATTTTCCGC
GAAATCGGCCAAACCTACCTGTCGTACACCTATACCGACATTTCTTCCGTCTTCCTCGAAGCCGGCTCCTCGGCT
TTCTCGCAGCACGCCGACGGCATGGTCTTCCAGCTCTTCGACGCGGAAAAGGACCCCCTGGCTCAAGGCTTTGCC
CAGGCTGCCTACGACTTGATCGTCGCCTTTTACGTCATCCACGCGACAAGTCATCTGGAACGATGCCTGTGCAAC
CTCCGCAAGCTGCTGAAGCCAGGCGGGTTTCTTGTCGTTGGCGAGGCCCAGGAGGTGCAGCATGACCTTGCCAGA
TCCGGCTTCATCTTTGGGACCTTGCCCGGTTGGTGGCTCGGGGCCGACTCAGGGCGGAACCTGTCGCCCCAGGTG
TCTCTTCATGAGTGGGATCGACTGCTCAGGTCGACCGGCTTCTCCGGCGTCGATGCAACTCCTCCGGAGGACTTT
AGAGAAACCTTTGGCGTCTGCCACTTCGTCTCCCAGGCCATCGATGATCAAGTAAATTTCCTCCGAGAGCCCCTT
GTCTCGGCGTGCCGTCCACCCCCCCTCGACAAGGTGGTCATTATTGGTGGTCAGTCGCCTCGCAGCTCGCACCTG
TCTCAAGGACTCGAGGCCACTTTCAGAGCGGGCTTTTCAACACAAGTCCATGCCTTCAAGACCCTTGTCGACGTC
GACTTCTCCGTGGTGGACGCCCATTCTGCAGTCGTCAGTCTGGTGGAGCTCGACCGGCCCATCTTCGAGGACATG
ACGGCAGAGACCTTCGAGGCACTCAAGACCATGTACGCCTTGCCCAAGACGCTCCTTTGGGTGACCAGCGGTCGG
CTTGGGGACGAGCCCTTTGCCAACATGACGGTTGGCTTCGGCCGAACGGCCAGGCACGAGACGCCCGACCTGCAC
ATCCAGCAGCTGGACATTGCAGACCCCCATCGAACCAGCCCCCAGACTATTGCCGAGCTTCTCCTCCGCCTGAAG
GCAACCGTCTCTAGTAGCAATTACACCGGAAACGCCGAGCCCGAAATAGTCATTGATGAGAAGCAGCGCCAGTTT
GTATCGCGACTCCGTCCCATACGCGAGCTCAACGACCGCTACAATTCGGCCCGTCGGTCCATCAAGCACGAGGTC
GAGGCGGCCAAATCATGTATAGAAATCAGGCCCACTCCCAAGGGATACGTGATGCAGGCGCTGCCTAGATATGCG
TCGTCGACGCCCAAGGGTTTCGTTTCGCTGGAGGTCACGCACACAACAATCTCCGCTCTGCCGACTCCTTTTGGG
CCCAAGTTTCTAGCGCTCGGGGTGGATGCAACGGCTGGAGTTTCGTACATGGCTCTTATTCCATCGCTGGCCTCG
GTTGTCAACGTTTCGTCCAAGTCCCTTGTCTACTGCCAGACATCGGGCCCCCTCGACGGGGTCGAGCTGCTCGCC
ACGACCGGGGCTCATCTGATCTCCAAGGCCGCTCTCGATCCGCTCAGTCGCGGGCAGACACTTCTAGCACATAAC
GCCACGAGCCTAGTAGCCCGGGCCCTCGCTATGCAGGCGGCTGTCAAGGGCGTGTCGGTCGTGTTCTCGACAGAC
GCCTCTGAGCGCCAAGTACCCGACTCGTGGCACAATCTTGCCCCTTACTTGAGCCAAGTTGAGCTCGATGAGTTC
CTTCTCTTCAACCCCTCGGCGTTCCTGGGCATGTCCAAGGATGAGGTCCAGAGGTCCGCCAACGAGACCGGCCTG
GCATCGAGCCTCCCCCCCTATTGCCATACCATGACGACTAAGACGGTGTTTTCCTCGATTGGATGCGAAAGTAGC
CCGTGCAGCGACGTTTCCCTGAAGGATATGCTATGCGTGGCCCTCAACTACGCACAGGAGCATCTCCTGGGAAAG
ATTCCCCGTCCATTGAAGGCGTCAATCCTTCGCCTGGACAGTTTCTCCGAAGGAGCACACCCTGAGGACCCGCTG
TCCATCGTCGACTGGACAGCCGCCACTTCGCTCTCAGTTCCTGTCTGCAGACTTGATGTGAAGCCCATGTTCAAG
GGGGCTGACAGCACTTACTGGGTCGTAGGAATGACTGGTGGGATGGGCATTTCGCTCTGTGACTGGATGATTAGC
AAGGGTGCTAGAAACATTGTCCTTACCAGCAGGAATCCAGACGTGGCTCCCGAATGGATCGAATATCACAGAAAG
AGAAAGGCCAACGTCGTTGTCATCGCATGGTTAGACCCAGCCCCCGACCCCCACACCCACTGGCCAGGTGGCAAG
CTAACGGATCTATACACTTGTAGCGATGCCACCGACGAGGCCGCCCTGAGGGCAGTCCACCAGAGGATTTGCGAA
ACTCTCCCGCCCATTGTTGGCGTTGCCAATGGGCCCATGGTGTTGCGTGATACTTCGATTCGCAACATGTCGTAT
GAAGAGCTGATGGACGTCGTCAGACCCAAGGTCAAATCGAGCATCTACCTCGACCGCATCTTCCATGACGACGAC
CTCGACTTTTTCATCCTCATCTCTTCCCTCAACTCCATTGTCGGCAACATCGGCCAGGCCAATTACGCAGCCGGG
AACTCATTCCTGGGCGGGCTCGCGGCCCACCGCCGGAAGCGCGGGCTCCGGGCCGCTGCCGTCAACTTTGGGGCC
ATCACCGGCGCCGGCTTCATTGAACGCGAGTCTAGCCGCGGAATCGACCTGTTTGTCAAGATTTTCCACCTCATG
CGCCTCTCCGAGGAAGACTGGTATCAGTCGGTCTGCGAGACCATTGACGCGTGCCGCCTAGACTCCCCGCATGGG
CCGGAGCTCACGACTGGTCTTCAGGATATTTCCATCGACTCCTCTGACGTTCCTTACTGGGCTTTCAATCCCAAG
TTCCTATACTTCACCATTCAGAAAAAGGCAGCGAGCACAGGCAAAGACGTGGGAAATACGACTGCGTCGATTCGA
GAGCTCGTTCGGGTGTGCCAATCTCAGGCGGAGCTATCCGAGGTCATCGGACGTAAGTCGGAATTTCCCGAGATT
TTAGCAGTAATACTTACTTGGAACACAGACGCTCTGGCCGATCAGTTGCGCAAGAGGCTACAGGTGACCATTGGC
GACGAAGAGATTCTTGCCGCGCGCAGCAACGAGATCGGCATCGATTCCCTCGTGTCCGCCGATATCCGCGTATGG
TTCCTCAAGAACCTGCAGACCAGCATACCCATCCTGAAGATCATCGGGAACGACACCATGGCGAGCCTGGTGCAA
TTGGCCGTCGACGGTATGCCGGCCGAGCTGGTGCCGCAAATATCTGGCGCCGACGGGGTGGACAGGACCGCGTTG
GCCGAGGCGAGCGGACAGCAGGATAAGGTGAACGGAGCCAATGGGTCTGAGCAGGCCGAGGTGAACGGGGCCAAT
GGGTCTCAGCAGGCCGGGGTAAACGGAAGCCAAGGTGCGAAAGGGTTCACTTGGAAGGATCAAGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail