Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5514
Gene name
Locationscaffold_452:15032..16655
Strand-
Gene length (bp)1623
Transcript length (bp)1461
Coding sequence length (bp)1458
Protein length (aa) 486

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.0E-20 71 394

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q503P5|MFSD7_DANRE Major facilitator superfamily domain-containing protein 7 OS=Danio rerio GN=mfsd7 PE=2 SV=1 42 414 1.0E-43
sp|Q6UXD7|MFSD7_HUMAN Major facilitator superfamily domain-containing protein 7 OS=Homo sapiens GN=MFSD7 PE=2 SV=1 46 426 3.0E-41
sp|Q28FF3|MFS7A_XENTR Major facilitator superfamily domain-containing protein 7-a OS=Xenopus tropicalis GN=mfsd7-A PE=2 SV=1 32 422 3.0E-41
sp|Q8CE47|MFSD7_MOUSE Major facilitator superfamily domain-containing protein 7 OS=Mus musculus GN=Mfsd7 PE=2 SV=1 58 426 9.0E-41
sp|Q11073|YT45_CAEEL Uncharacterized protein B0416.5 OS=Caenorhabditis elegans GN=B0416.5 PE=4 SV=1 25 422 1.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q503P5|MFSD7_DANRE Major facilitator superfamily domain-containing protein 7 OS=Danio rerio GN=mfsd7 PE=2 SV=1 42 414 1.0E-43
sp|Q6UXD7|MFSD7_HUMAN Major facilitator superfamily domain-containing protein 7 OS=Homo sapiens GN=MFSD7 PE=2 SV=1 46 426 3.0E-41
sp|Q28FF3|MFS7A_XENTR Major facilitator superfamily domain-containing protein 7-a OS=Xenopus tropicalis GN=mfsd7-A PE=2 SV=1 32 422 3.0E-41
sp|Q8CE47|MFSD7_MOUSE Major facilitator superfamily domain-containing protein 7 OS=Mus musculus GN=Mfsd7 PE=2 SV=1 58 426 9.0E-41
sp|Q11073|YT45_CAEEL Uncharacterized protein B0416.5 OS=Caenorhabditis elegans GN=B0416.5 PE=4 SV=1 25 422 1.0E-40
sp|Q6P3R2|MFS7B_XENTR Major facilitator superfamily domain-containing protein 7-b OS=Xenopus tropicalis GN=mfsd7-B PE=2 SV=1 9 412 2.0E-39
sp|Q9N1F2|FLVC1_FELCA Feline leukemia virus subgroup C receptor-related protein 1 OS=Felis catus GN=FLVCR1 PE=1 SV=1 32 451 1.0E-33
sp|Q9Y5Y0|FLVC1_HUMAN Feline leukemia virus subgroup C receptor-related protein 1 OS=Homo sapiens GN=FLVCR1 PE=1 SV=1 32 451 2.0E-33
sp|P60815|FLVC2_RAT Feline leukemia virus subgroup C receptor-related protein 2 OS=Rattus norvegicus GN=Flvcr2 PE=2 SV=1 46 467 9.0E-31
sp|O01735|YC91_CAEEL Uncharacterized MFS-type transporter C09D4.1 OS=Caenorhabditis elegans GN=C09D4.1 PE=3 SV=2 6 429 6.0E-30
sp|Q9ES43|FLVC1_MUSTR Feline leukemia virus subgroup C receptor-related protein 1 OS=Mus terricolor GN=Flvcr1 PE=2 SV=1 32 451 7.0E-29
sp|Q9UPI3|FLVC2_HUMAN Feline leukemia virus subgroup C receptor-related protein 2 OS=Homo sapiens GN=FLVCR2 PE=1 SV=1 61 467 7.0E-29
sp|Q91X85|FLVC2_MOUSE Feline leukemia virus subgroup C receptor-related protein 2 OS=Mus musculus GN=Flvcr2 PE=1 SV=2 46 429 1.0E-28
sp|B2RXV4|FLVC1_MOUSE Feline leukemia virus subgroup C receptor-related protein 1 OS=Mus musculus GN=Flvcr1 PE=2 SV=1 32 451 3.0E-28
sp|Q6GNV7|DIRC2_XENLA Disrupted in renal carcinoma protein 2 homolog OS=Xenopus laevis GN=dirc2 PE=2 SV=1 43 402 3.0E-21
sp|Q501I9|DIRC2_XENTR Disrupted in renal carcinoma protein 2 homolog OS=Xenopus tropicalis GN=dirc2 PE=2 SV=1 43 407 1.0E-13
sp|Q66H95|DIRC2_RAT Disrupted in renal carcinoma protein 2 homolog OS=Rattus norvegicus GN=Dirc2 PE=2 SV=1 58 407 9.0E-11
sp|Q8BFQ6|DIRC2_MOUSE Disrupted in renal carcinoma protein 2 homolog OS=Mus musculus GN=Dirc2 PE=2 SV=1 58 407 3.0E-10
sp|Q96SL1|DIRC2_HUMAN Disrupted in renal carcinoma protein 2 OS=Homo sapiens GN=DIRC2 PE=1 SV=1 58 407 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 64 86 22
2 101 123 22
3 130 148 18
4 158 180 22
5 193 215 22
6 225 247 22
7 270 292 22
8 312 334 22
9 339 361 22
10 371 393 22
11 406 426 20
12 441 463 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 62.49 34.69 90.29
CcL In ants, during behavior modification 72.10 36.93 107.26
CcD In ants, recently dead 42.92 22.90 62.94

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.582940 no
SC16a CcD 0.107910 no
CcL CcD 0.026478 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5514
MRLDLSSSSSSSNTPDLNAGRPRHDPSKLAVHTDDRRLPPLAADDHPHHLPSQSVQYRSYKRRWFGLLQLSLMNL
IVSVDWLTYAPVADAAAQYYRTTLTAINWLSTAFFLAFVVVSPLTIFALHRGPKLAFVVAAILMLVGNWIRYAGS
ARSDGGNIVVAVVGQVIVGFAQPFILAAPTRYSDIWFTERGRVAATALASLANPLGGALAQLVIPMVVKRPADVS
GLVLYVAIISTICCLPAFLLPSHPPTPVGASAETSKLGFRESMHLIVHSPELWIVFVPFAVNVGFFNSFSSLLNQ
IMVPYGFTNDEAGIGGAILIFVGLVFAAVSSPLIDRTKAFVLALKILLPLIALCYVIFIWMPETRRLAGPYIVVA
LLGAASFASLPVALEFLTEVSYPLSPEVTSTIAWAGGQLLGAVFILISGALADGPDAHPPGNLKRALIFQGVIAA
AACPLPLFLGLFGRRDKVALRRIGSDRRSGVPDASA
Coding >Ophio5|5514
ATGAGACTCGACCTCTCCTCCTCCTCCTCGTCTAGCAACACCCCCGACCTCAACGCCGGCCGCCCCCGTCATGAC
CCGTCCAAGCTTGCCGTCCACACGGACGACCGCCGGCTTCCTCCCTTGGCAGCCGACGACCACCCCCATCATCTT
CCAAGCCAGTCGGTCCAGTACCGATCCTATAAGCGCCGCTGGTTCGGCCTCTTACAGCTGTCGCTCATGAACCTC
ATCGTCTCCGTGGACTGGCTCACTTACGCCCCCGTGGCCGACGCCGCTGCCCAGTACTATCGCACCACCCTGACG
GCCATCAACTGGCTCAGCACCGCCTTCTTCCTCGCCTTCGTCGTCGTCTCCCCACTCACCATCTTCGCTCTCCAC
CGTGGGCCCAAGCTGGCCTTTGTCGTCGCCGCTATTCTCATGCTCGTCGGCAATTGGATCCGATATGCCGGCTCC
GCCCGCTCCGATGGCGGTAATATCGTCGTTGCCGTCGTCGGCCAGGTCATCGTCGGCTTCGCCCAGCCTTTTATC
CTCGCTGCCCCGACCAGATACTCGGATATCTGGTTCACCGAGCGTGGCCGCGTCGCTGCTACCGCTCTGGCCAGT
CTGGCTAATCCGCTGGGCGGCGCTCTCGCTCAGCTCGTCATCCCCATGGTTGTCAAAAGGCCTGCCGACGTCTCG
GGCCTGGTGCTCTACGTCGCCATCATCTCGACCATCTGTTGCCTCCCGGCTTTCCTTCTCCCGTCTCACCCCCCA
ACTCCCGTCGGGGCCTCGGCCGAGACGTCCAAGCTCGGCTTCCGCGAGTCGATGCATCTAATCGTCCACTCTCCG
GAGCTCTGGATCGTCTTCGTACCCTTCGCCGTCAACGTCGGCTTCTTCAACTCCTTCTCCTCTCTCCTCAACCAG
ATCATGGTGCCGTATGGCTTCACTAACGACGAAGCTGGCATCGGCGGCGCCATCCTCATCTTCGTCGGCCTCGTC
TTCGCCGCCGTCAGCTCGCCGCTCATAGACCGCACCAAGGCCTTCGTCCTCGCCCTCAAGATCCTGCTGCCCCTC
ATCGCCCTCTGCTACGTCATCTTCATCTGGATGCCCGAGACGCGCCGCCTCGCCGGTCCCTACATCGTCGTCGCC
CTTCTCGGTGCCGCCAGCTTCGCCTCCCTCCCGGTCGCCCTCGAGTTTCTCACCGAGGTCAGCTACCCCCTGAGC
CCCGAGGTGACGTCGACCATCGCCTGGGCCGGCGGTCAGCTCCTCGGCGCCGTCTTCATCCTCATCAGCGGTGCC
CTCGCCGATGGCCCGGATGCCCACCCCCCGGGCAATCTGAAGCGGGCCCTCATCTTCCAGGGCGTCATCGCCGCC
GCTGCTTGCCCGCTGCCCCTCTTCCTTGGTCTCTTTGGCCGCAGGGACAAGGTGGCGCTGAGACGCATTGGCTCG
GACAGGCGCAGCGGGGTGCCGGATGCCTCCGCA
Transcript >Ophio5|5514
ATGAGACTCGACCTCTCCTCCTCCTCCTCGTCTAGCAACACCCCCGACCTCAACGCCGGCCGCCCCCGTCATGAC
CCGTCCAAGCTTGCCGTCCACACGGACGACCGCCGGCTTCCTCCCTTGGCAGCCGACGACCACCCCCATCATCTT
CCAAGCCAGTCGGTCCAGTACCGATCCTATAAGCGCCGCTGGTTCGGCCTCTTACAGCTGTCGCTCATGAACCTC
ATCGTCTCCGTGGACTGGCTCACTTACGCCCCCGTGGCCGACGCCGCTGCCCAGTACTATCGCACCACCCTGACG
GCCATCAACTGGCTCAGCACCGCCTTCTTCCTCGCCTTCGTCGTCGTCTCCCCACTCACCATCTTCGCTCTCCAC
CGTGGGCCCAAGCTGGCCTTTGTCGTCGCCGCTATTCTCATGCTCGTCGGCAATTGGATCCGATATGCCGGCTCC
GCCCGCTCCGATGGCGGTAATATCGTCGTTGCCGTCGTCGGCCAGGTCATCGTCGGCTTCGCCCAGCCTTTTATC
CTCGCTGCCCCGACCAGATACTCGGATATCTGGTTCACCGAGCGTGGCCGCGTCGCTGCTACCGCTCTGGCCAGT
CTGGCTAATCCGCTGGGCGGCGCTCTCGCTCAGCTCGTCATCCCCATGGTTGTCAAAAGGCCTGCCGACGTCTCG
GGCCTGGTGCTCTACGTCGCCATCATCTCGACCATCTGTTGCCTCCCGGCTTTCCTTCTCCCGTCTCACCCCCCA
ACTCCCGTCGGGGCCTCGGCCGAGACGTCCAAGCTCGGCTTCCGCGAGTCGATGCATCTAATCGTCCACTCTCCG
GAGCTCTGGATCGTCTTCGTACCCTTCGCCGTCAACGTCGGCTTCTTCAACTCCTTCTCCTCTCTCCTCAACCAG
ATCATGGTGCCGTATGGCTTCACTAACGACGAAGCTGGCATCGGCGGCGCCATCCTCATCTTCGTCGGCCTCGTC
TTCGCCGCCGTCAGCTCGCCGCTCATAGACCGCACCAAGGCCTTCGTCCTCGCCCTCAAGATCCTGCTGCCCCTC
ATCGCCCTCTGCTACGTCATCTTCATCTGGATGCCCGAGACGCGCCGCCTCGCCGGTCCCTACATCGTCGTCGCC
CTTCTCGGTGCCGCCAGCTTCGCCTCCCTCCCGGTCGCCCTCGAGTTTCTCACCGAGGTCAGCTACCCCCTGAGC
CCCGAGGTGACGTCGACCATCGCCTGGGCCGGCGGTCAGCTCCTCGGCGCCGTCTTCATCCTCATCAGCGGTGCC
CTCGCCGATGGCCCGGATGCCCACCCCCCGGGCAATCTGAAGCGGGCCCTCATCTTCCAGGGCGTCATCGCCGCC
GCTGCTTGCCCGCTGCCCCTCTTCCTTGGTCTCTTTGGCCGCAGGGACAAGGTGGCGCTGAGACGCATTGGCTCG
GACAGGCGCAGCGGGGTGCCGGATGCCTCCGCATAG
Gene >Ophio5|5514
ATGAGACTCGACCTCTCCTCCTCCTCCTCGTCTAGCAACACCCCCGACCTCAACGCCGGCCGCCCCCGTCATGAC
CCGTCCAAGCTTGCCGTCCACACGGACGACCGCCGGCTTCCTCCCTTGGCAGCCGACGACCACCCCCATCATCTT
CCAAGCCAGTCGGTCCAGTACCGATCCTATAAGCGCCGCTGGTTCGGCCTCTTACAGCTGTCGCTCATGAACCTC
ATCGTCTCCGTGGACGTATGTTCTACCCAACTTCCCATTTCTACCTGATACTCCATGGTAAACTGACTCCTCAAC
TCCCCTTTCCCCCCCCTATCCAGTGGCTCACTTACGCCCCCGTGGCCGACGCCGCTGCCCAGTACTATCGCACCA
CCCTGACGGCCATCAACTGGCTCAGCACCGCCTTCTTCCTCGCCTTCGTCGTCGTCTCCCCACTCACCATCTTCG
CTCTCCACCGTGGGCCCAAGCTGGCCTTTGTCGTCGCCGCTATTCTCATGCTCGTCGGCAATTGGATCCGATATG
CCGGCTCCGCCCGCTCCGATGGCGGTAATATCGTCGTTGCCGTCGTCGGCCAGGTCATCGTCGGCTTCGCCCAGC
CTTTTATCCTCGCTGCCCCGACCAGATACTCGGATATCTGGTTCACCGAGCGTGGCCGCGTCGCTGCTACCGCTC
TGGCCAGTCTGGCTAATCCGCTGGGCGGCGCTCTCGCTCAGCTCGTCATCCCCATGGTTGTCAAAAGGCCTGCCG
ACGTCTCGGGCCTGGTGCTCTACGTCGCCATCATCGTATGTAGCCTCCTCTCCCTCTCCCCAACGACTTCGCCGA
GATGCCCTCTGTCGCTGACACGACTTCCCATCTGCCTAGTCGACCATCTGTTGCCTCCCGGCTTTCCTTCTCCCG
TCTCACCCCCCAACTCCCGTCGGGGCCTCGGCCGAGACGTCCAAGCTCGGCTTCCGCGAGTCGATGCATCTAATC
GTCCACTCTCCGGAGCTCTGGATCGTCTTCGTACCCTTCGCCGTCAACGTCGGCTTCTTCAACTCCTTCTCCTCT
CTCCTCAACCAGATCATGGTGCCGTATGGCTTCACTAACGACGAAGCTGGCATCGGCGGCGCCATCCTCATCTTC
GTCGGCCTCGTCTTCGCCGCCGTCAGCTCGCCGCTCATAGACCGCACCAAGGCCTTCGTCCTCGCCCTCAAGATC
CTGCTGCCCCTCATCGCCCTCTGCTACGTCATCTTCATCTGGATGCCCGAGACGCGCCGCCTCGCCGGTCCCTAC
ATCGTCGTCGCCCTTCTCGGTGCCGCCAGCTTCGCCTCCCTCCCGGTCGCCCTCGAGTTTCTCACCGAGGTCAGC
TACCCCCTGAGCCCCGAGGTGACGTCGACCATCGCCTGGGCCGGCGGTCAGCTCCTCGGCGCCGTCTTCATCCTC
ATCAGCGGTGCCCTCGCCGATGGCCCGGATGCCCACCCCCCGGGCAATCTGAAGCGGGCCCTCATCTTCCAGGGC
GTCATCGCCGCCGCTGCTTGCCCGCTGCCCCTCTTCCTTGGTCTCTTTGGCCGCAGGGACAAGGTGGCGCTGAGA
CGCATTGGCTCGGACAGGCGCAGCGGGGTGCCGGATGCCTCCGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail