Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5509
Gene name
Locationscaffold_451:14190..16903
Strand-
Gene length (bp)2713
Transcript length (bp)2289
Coding sequence length (bp)2286
Protein length (aa) 762

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O60056|YG55_SCHPO Uncharacterized transcriptional regulatory protein C56F2.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC56F2.05c PE=3 SV=1 673 711 6.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 732 754 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5509
MHTSCSSAIVIASDARARQRPRRLVCLVGRPLTANPAAAVVAAAQARSRRLESALTRLRPSTVLPSHHHDIVGPF
SWALPLAQPSRACPPTHTRTHTHKHTHTHRNTKPANPTPPLLSSPLPPIPLPSLLQPPPRIVMAFMSPIDTSVAA
VSGPSSNAGSVSPRQTATPKNVAFELMFSNSPQYRARLPMRVQIYPHDTTDSIVTTVKNFYGLYSGPTGSKGVSF
EDDNGNTLIARYENFANNMVVYVRVIEEPPPAFAPTPFHPGPESYFAGDGFPAQQPQQRFEHDMLRPESRASNRR
SASPSAARDRRSVSASTSCKKGRSRINGYSSGDGAPSTASAKNKEHLGNTDISVENIVEGGRRKRAKFESSELPL
FAPPQMPAATSNPSVSPARRVDHQRPSMPFVHPGQSPFTNPRPMQSPQSYGNGAVHPVMYVTPIGQGHRSRGSMG
YASSGSGVATGLGVLPTPDPTVGSCMSEEDKDVAIQLMRLGESSNISHGRTSASTMDDTFSGHADAASSTGATSD
GGSDSERDGPAPRRQKLDASGGSKPIYETTEAHFMPTTERGDVSGDDADFEDGANSSVGDVLHAKPGVPAPVKKQ
SSAKHKTAPSAPKLAASNSKAARPPSSKAKKPPSVVAAGPMSPTSIRHSRKPSTASTGLAPQPGEDDQPDLSTKP
RCQRCRKSKKGCDRQRPCGRCRDAGLSAEQCISEDEGNGRKGRYGRHMGVPIKQEEAASVAAAPGLLPAAPITAA
AVGVDKAKKRKR
Coding >Ophio5|5509
ATGCACACATCCTGTTCTTCTGCCATCGTTATCGCCTCGGACGCAAGAGCACGACAACGCCCTCGTCGCCTCGTC
TGCTTAGTCGGTCGTCCGCTCACCGCAAACCCTGCGGCAGCTGTCGTCGCCGCCGCGCAAGCCCGGAGCCGACGG
CTCGAGTCGGCGCTTACCCGTCTGCGGCCTTCGACCGTTTTGCCCTCGCACCACCACGACATCGTCGGGCCCTTT
TCTTGGGCGTTACCGCTTGCTCAGCCCTCTCGGGCCTGCCCACCCACACACACACGCACACACACACACAAGCAC
ACGCACACGCACCGCAACACAAAACCCGCAAATCCTACTCCCCCTCTCCTCTCCTCCCCTCTGCCCCCGATCCCC
CTCCCCAGCCTTCTACAACCTCCACCTCGCATCGTCATGGCCTTCATGTCGCCCATAGACACCTCGGTCGCCGCC
GTCTCGGGCCCCTCGTCCAACGCTGGCAGCGTCTCGCCGCGGCAGACGGCGACGCCCAAGAACGTCGCATTCGAG
TTGATGTTCTCCAACTCGCCCCAGTATCGCGCGCGCCTACCCATGCGGGTCCAGATCTATCCCCATGATACCACC
GACTCCATTGTCACCACGGTCAAGAATTTCTACGGTCTGTATTCTGGCCCGACCGGCTCCAAGGGCGTGAGCTTC
GAGGACGACAATGGCAATACCCTCATCGCGCGCTATGAAAACTTTGCCAACAACATGGTCGTCTACGTACGTGTC
ATTGAGGAGCCTCCCCCGGCCTTTGCGCCTACTCCCTTCCATCCCGGGCCAGAGTCATACTTCGCCGGCGACGGC
TTCCCGGCCCAGCAGCCGCAGCAGCGCTTCGAGCACGACATGCTCAGGCCCGAATCCCGGGCGTCGAACCGCCGC
AGCGCCTCGCCCAGCGCCGCTCGCGACCGGCGAAGCGTCTCGGCGAGCACCTCTTGCAAGAAGGGGCGGTCTCGC
ATCAACGGCTATAGCAGCGGCGATGGCGCCCCCAGCACCGCGTCTGCCAAGAACAAGGAGCACCTGGGCAATACC
GACATCAGCGTCGAGAACATCGTCGAGGGGGGCCGGCGCAAGAGGGCCAAGTTTGAGAGCTCGGAGCTGCCTCTG
TTTGCGCCCCCGCAGATGCCGGCGGCCACGTCCAACCCCTCGGTGTCACCAGCCCGCCGCGTCGACCACCAGCGG
CCGTCGATGCCGTTTGTCCATCCGGGCCAGAGCCCCTTTACGAACCCTCGGCCCATGCAGTCCCCGCAGAGCTAC
GGCAATGGCGCTGTTCATCCCGTTATGTACGTTACGCCCATCGGCCAGGGCCACCGCTCGCGTGGCAGCATGGGA
TATGCCAGCAGCGGCAGCGGCGTCGCCACCGGCCTGGGCGTCCTGCCGACGCCCGATCCCACCGTGGGCAGCTGC
ATGTCCGAGGAAGACAAGGACGTGGCCATCCAGCTGATGAGGCTCGGTGAGTCGTCCAACATCTCGCACGGTCGC
ACCTCGGCCTCGACCATGGACGACACCTTTAGCGGCCACGCCGACGCCGCTTCCTCCACTGGCGCCACCAGCGAT
GGCGGCAGCGATAGCGAGCGCGACGGCCCGGCCCCGCGCCGCCAGAAGCTGGACGCCTCAGGCGGCTCCAAGCCC
ATCTATGAGACGACTGAGGCGCACTTCATGCCCACGACCGAGAGGGGCGACGTCAGCGGTGACGACGCCGACTTT
GAAGACGGCGCAAACAGCTCCGTAGGCGACGTGCTTCACGCCAAGCCCGGCGTCCCCGCCCCCGTCAAGAAGCAG
TCATCGGCCAAGCACAAGACGGCGCCGTCGGCGCCCAAGCTGGCGGCCTCCAATTCCAAGGCCGCGCGGCCTCCC
AGCTCCAAGGCCAAGAAGCCGCCGTCTGTGGTGGCGGCCGGGCCCATGTCGCCGACATCCATCAGGCACTCTCGC
AAGCCGTCGACGGCCTCAACCGGATTGGCGCCCCAGCCTGGCGAGGACGACCAGCCGGACCTGTCAACCAAGCCC
CGCTGCCAGAGATGCCGCAAGAGCAAGAAGGGCTGCGACCGCCAACGCCCGTGCGGACGTTGCCGCGACGCGGGG
CTCTCGGCCGAGCAGTGCATCAGCGAGGACGAGGGGAACGGACGCAAGGGCCGATACGGTCGCCACATGGGCGTT
CCCATCAAGCAAGAAGAGGCCGCCTCTGTCGCTGCTGCGCCCGGCTTGCTACCTGCCGCGCCCATCACCGCCGCA
GCCGTGGGAGTCGACAAGGCAAAGAAGCGCAAGCGG
Transcript >Ophio5|5509
ATGCACACATCCTGTTCTTCTGCCATCGTTATCGCCTCGGACGCAAGAGCACGACAACGCCCTCGTCGCCTCGTC
TGCTTAGTCGGTCGTCCGCTCACCGCAAACCCTGCGGCAGCTGTCGTCGCCGCCGCGCAAGCCCGGAGCCGACGG
CTCGAGTCGGCGCTTACCCGTCTGCGGCCTTCGACCGTTTTGCCCTCGCACCACCACGACATCGTCGGGCCCTTT
TCTTGGGCGTTACCGCTTGCTCAGCCCTCTCGGGCCTGCCCACCCACACACACACGCACACACACACACAAGCAC
ACGCACACGCACCGCAACACAAAACCCGCAAATCCTACTCCCCCTCTCCTCTCCTCCCCTCTGCCCCCGATCCCC
CTCCCCAGCCTTCTACAACCTCCACCTCGCATCGTCATGGCCTTCATGTCGCCCATAGACACCTCGGTCGCCGCC
GTCTCGGGCCCCTCGTCCAACGCTGGCAGCGTCTCGCCGCGGCAGACGGCGACGCCCAAGAACGTCGCATTCGAG
TTGATGTTCTCCAACTCGCCCCAGTATCGCGCGCGCCTACCCATGCGGGTCCAGATCTATCCCCATGATACCACC
GACTCCATTGTCACCACGGTCAAGAATTTCTACGGTCTGTATTCTGGCCCGACCGGCTCCAAGGGCGTGAGCTTC
GAGGACGACAATGGCAATACCCTCATCGCGCGCTATGAAAACTTTGCCAACAACATGGTCGTCTACGTACGTGTC
ATTGAGGAGCCTCCCCCGGCCTTTGCGCCTACTCCCTTCCATCCCGGGCCAGAGTCATACTTCGCCGGCGACGGC
TTCCCGGCCCAGCAGCCGCAGCAGCGCTTCGAGCACGACATGCTCAGGCCCGAATCCCGGGCGTCGAACCGCCGC
AGCGCCTCGCCCAGCGCCGCTCGCGACCGGCGAAGCGTCTCGGCGAGCACCTCTTGCAAGAAGGGGCGGTCTCGC
ATCAACGGCTATAGCAGCGGCGATGGCGCCCCCAGCACCGCGTCTGCCAAGAACAAGGAGCACCTGGGCAATACC
GACATCAGCGTCGAGAACATCGTCGAGGGGGGCCGGCGCAAGAGGGCCAAGTTTGAGAGCTCGGAGCTGCCTCTG
TTTGCGCCCCCGCAGATGCCGGCGGCCACGTCCAACCCCTCGGTGTCACCAGCCCGCCGCGTCGACCACCAGCGG
CCGTCGATGCCGTTTGTCCATCCGGGCCAGAGCCCCTTTACGAACCCTCGGCCCATGCAGTCCCCGCAGAGCTAC
GGCAATGGCGCTGTTCATCCCGTTATGTACGTTACGCCCATCGGCCAGGGCCACCGCTCGCGTGGCAGCATGGGA
TATGCCAGCAGCGGCAGCGGCGTCGCCACCGGCCTGGGCGTCCTGCCGACGCCCGATCCCACCGTGGGCAGCTGC
ATGTCCGAGGAAGACAAGGACGTGGCCATCCAGCTGATGAGGCTCGGTGAGTCGTCCAACATCTCGCACGGTCGC
ACCTCGGCCTCGACCATGGACGACACCTTTAGCGGCCACGCCGACGCCGCTTCCTCCACTGGCGCCACCAGCGAT
GGCGGCAGCGATAGCGAGCGCGACGGCCCGGCCCCGCGCCGCCAGAAGCTGGACGCCTCAGGCGGCTCCAAGCCC
ATCTATGAGACGACTGAGGCGCACTTCATGCCCACGACCGAGAGGGGCGACGTCAGCGGTGACGACGCCGACTTT
GAAGACGGCGCAAACAGCTCCGTAGGCGACGTGCTTCACGCCAAGCCCGGCGTCCCCGCCCCCGTCAAGAAGCAG
TCATCGGCCAAGCACAAGACGGCGCCGTCGGCGCCCAAGCTGGCGGCCTCCAATTCCAAGGCCGCGCGGCCTCCC
AGCTCCAAGGCCAAGAAGCCGCCGTCTGTGGTGGCGGCCGGGCCCATGTCGCCGACATCCATCAGGCACTCTCGC
AAGCCGTCGACGGCCTCAACCGGATTGGCGCCCCAGCCTGGCGAGGACGACCAGCCGGACCTGTCAACCAAGCCC
CGCTGCCAGAGATGCCGCAAGAGCAAGAAGGGCTGCGACCGCCAACGCCCGTGCGGACGTTGCCGCGACGCGGGG
CTCTCGGCCGAGCAGTGCATCAGCGAGGACGAGGGGAACGGACGCAAGGGCCGATACGGTCGCCACATGGGCGTT
CCCATCAAGCAAGAAGAGGCCGCCTCTGTCGCTGCTGCGCCCGGCTTGCTACCTGCCGCGCCCATCACCGCCGCA
GCCGTGGGAGTCGACAAGGCAAAGAAGCGCAAGCGGTAG
Gene >Ophio5|5509
ATGCACACATCCTGTTCTTCTGCCATCGTTATCGCCTCGGACGCAAGAGCACGACAACGCCCTCGTCGCCTCGTC
TGCTGTAAGCGATCGTCTCTCTGTCTTTGCTCTGTTCTTGTCTTCCCCATTCCCTGGCTCTCTCGAGGCGCGCTG
CATCGTCAGTCGCCTTTCTCCTCCTCTCCTCTCTCTCTCCCCCCCTCCCCCCTCTCCCCCCCAATTCCCCGGCGA
CCATGGGCTTCGTTCAGATTCTACTTGACCTTCTTCCAGAGCTTGAACCTTGAGCTGATGGCATCTTCTATCATA
GTAGTCGGTCGTCCGCTCACCGCAAACCCTGCGGCAGCTGTCGTCGCCGCCGCGCAAGCCCGGAGCCGACGGCTC
GAGTCGGCGCTTACCCGTCTGCGGCCTTCGACCGTTTTGCCCTCGCACCACCAGTCTCGACAGCCAGCTCTGTCG
GCGAATCGACAGTGACCTGGACGGCTGCACAGCGACATCGTCGGGCCCTTTTCTTGGGCGTTACCGCTTGCTCAG
CCCTCTCGGGCCTGCCCACCCACACACACACGCACACACACACACAAGCACACGCACACGCACCGCAACACAAAA
CCCGCAAATCCTACTCCCCCTCTCCTCTCCTCCCCTCTGCCCCCGATCCCCCTCCCCAGCCTTCTACAACCTCCA
CCTCGCATCGTCATGGCCTTCATGTCGCCCATAGACACCTCGGTCGCCGCCGTCTCGGGCCCCTCGTCCAACGCT
GGCAGCGTCTCGCCGCGGCAGACGGCGACGCCCAAGAACGTCGCATTCGAGTTGATGTTCTCCAACTCGCCCCAG
TATCGCGCGCGCCTACCCATGCGGGTCCAGATCTATCCCCATGATACCACCGACTCCATTGTCACCACGGTCAAG
AATTTCTACGGTCTGTATTCTGGCCCGACCGGCTCCAAGGGCGTGAGCTTCGAGGACGACAATGGCAATACCCTC
ATCGCGCGCTATGAAAACTTTGCCAACAACATGGTCGTCTACGTACGTGTCATTGAGGAGCCTCCCCCGGCCTTT
GCGCCTACTCCCTTCCATCCCGGGCCAGAGTCATACTTCGCCGGCGACGGCTTCCCGGCCCAGCAGCCGCAGCAG
CGCTTCGAGCACGACATGCTCAGGCCCGAATCCCGGGCGTCGAACCGCCGCAGCGCCTCGCCCAGCGCCGCTCGC
GACCGGCGAAGCGTCTCGGCGAGCACCTCTTGCAAGAAGGGGCGGTCTCGGTCTGTCAGAAACAGAGGGTCCGTG
GCCAACGGCCATGCTGACGCCTACAGCGACAGCATCAACGGCTATAGCAGCGGCGATGGCGCCCCCAGCACCGCG
TCTGCCAAGAACAAGGAGCACCTGGGCAATACCGACATCAGCGTCGAGAACATCGTCGAGGGGGGCCGGCGCAAG
AGGGCCAAGTTTGAGAGCTCGGTAGGCATCTTCTATCCCCTCTTCAGCCCGGCGCTCTCTTCCCTGCAATGGCGT
GTTCCGTCCCTCTTCGCAGGCTGACTATTCGCCCAAGGAGCTGCCTCTGTTTGCGCCCCCGCAGATGCCGGCGGC
CACGTCCAACCCCTCGGTGTCACCAGCCCGCCGCGTCGACCACCAGCGGCCGTCGATGCCGTTTGTCCATCCGGG
CCAGAGCCCCTTTACGAACCCTCGGCCCATGCAGTCCCCGCAGAGCTACGGCAATGGCGCTGTTCATCCCGTTAT
GTACGTTACGCCCATCGGCCAGGGCCACCGCTCGCGTGGCAGCATGGGATATGCCAGCAGCGGCAGCGGCGTCGC
CACCGGCCTGGGCGTCCTGCCGACGCCCGATCCCACCGTGGGCAGCTGCATGTCCGAGGAAGACAAGGACGTGGC
CATCCAGCTGATGAGGCTCGGTGAGTCGTCCAACATCTCGCACGGTCGCACCTCGGCCTCGACCATGGACGACAC
CTTTAGCGGCCACGCCGACGCCGCTTCCTCCACTGGCGCCACCAGCGATGGCGGCAGCGATAGCGAGCGCGACGG
CCCGGCCCCGCGCCGCCAGAAGCTGGACGCCTCAGGCGGCTCCAAGCCCATCTATGAGACGACTGAGGCGCACTT
CATGCCCACGACCGAGAGGGGCGACGTCAGCGGTGACGACGCCGACTTTGAAGACGGCGCAAACAGCTCCGTAGG
CGACGTGCTTCACGCCAAGCCCGGCGTCCCCGCCCCCGTCAAGAAGCAGTCATCGGCCAAGCACAAGACGGCGCC
GTCGGCGCCCAAGCTGGCGGCCTCCAATTCCAAGGCCGCGCGGCCTCCCAGCTCCAAGGCCAAGAAGCCGCCGTC
TGTGGTGGCGGCCGGGCCCATGTCGCCGACATCCATCAGGCACTCTCGCAAGCCGTCGACGGCCTCAACCGGATT
GGCGCCCCAGCCTGGCGAGGACGACCAGCCGGACCTGTCAACCAAGCCCCGCTGCCAGAGATGCCGCAAGAGCAA
GAAGGGCTGCGACCGCCAACGCCCGTGCGGACGTTGCCGCGACGCGGGGCTCTCGGCCGAGCAGTGCATCAGCGA
GGACGAGGGGAACGGACGCAAGGGCCGATACGGTCGCCACATGGGCGTTCCCATCAAGCAAGAAGAGGCCGCCTC
TGTCGCTGCTGCGCCCGGCTTGCTACCTGCCGCGCCCATCACCGCCGCAGCCGTGGGAGTCGACAAGGCAAAGAA
GCGCAAGCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail