Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5494
Gene name
Locationscaffold_45:48166..52498
Strand-
Gene length (bp)4332
Transcript length (bp)3798
Coding sequence length (bp)3795
Protein length (aa) 1265

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09763 Sec3_C Exocyst complex component Sec3 1.5E-50 567 737
PF09763 Sec3_C Exocyst complex component Sec3 1.4E-144 778 1249
PF15277 Sec3-PIP2_bind Exocyst complex component SEC3 N-terminal PIP2 binding PH 3.4E-29 68 163

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33332|SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC3 PE=1 SV=1 5 241 4.0E-27
sp|Q9NV70|EXOC1_HUMAN Exocyst complex component 1 OS=Homo sapiens GN=EXOC1 PE=1 SV=4 822 1213 5.0E-23
sp|Q9VVG4|EXOC1_DROME Exocyst complex component 1 OS=Drosophila melanogaster GN=Sec3 PE=1 SV=2 594 1264 1.0E-22
sp|Q8R3S6|EXOC1_MOUSE Exocyst complex component 1 OS=Mus musculus GN=Exoc1 PE=1 SV=4 822 1213 1.0E-21
sp|Q9SX85|SEC3A_ARATH Exocyst complex component SEC3A OS=Arabidopsis thaliana GN=SEC3A PE=1 SV=1 574 1250 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33332|SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC3 PE=1 SV=1 5 241 4.0E-27
sp|Q9NV70|EXOC1_HUMAN Exocyst complex component 1 OS=Homo sapiens GN=EXOC1 PE=1 SV=4 822 1213 5.0E-23
sp|Q9VVG4|EXOC1_DROME Exocyst complex component 1 OS=Drosophila melanogaster GN=Sec3 PE=1 SV=2 594 1264 1.0E-22
sp|Q8R3S6|EXOC1_MOUSE Exocyst complex component 1 OS=Mus musculus GN=Exoc1 PE=1 SV=4 822 1213 1.0E-21
sp|Q9SX85|SEC3A_ARATH Exocyst complex component SEC3A OS=Arabidopsis thaliana GN=SEC3A PE=1 SV=1 574 1250 2.0E-18
sp|Q9SX86|SEC3B_ARATH Exocyst complex component SEC3B OS=Arabidopsis thaliana GN=SEC3B PE=2 SV=1 574 1250 3.0E-17
sp|Q20678|EXOC1_CAEEL Exocyst complex component 1 OS=Caenorhabditis elegans GN=sec-3 PE=3 SV=2 866 1254 7.0E-10
sp|Q54NV1|EXOC1_DICDI Exocyst complex component 1 OS=Dictyostelium discoideum GN=exoc1 PE=3 SV=1 984 1264 2.0E-08
sp|P33332|SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC3 PE=1 SV=1 610 701 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000145 exocyst Yes
GO:0006887 exocytosis Yes
GO:0046903 secretion No
GO:0016192 vesicle-mediated transport No
GO:0009987 cellular process No
GO:0140352 export from cell No
GO:0099023 vesicle tethering complex No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0032991 protein-containing complex No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0032940 secretion by cell No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5494
MDRVNGASAAASRAERFEDEKRRIIESCFNKREPDGSLIETYITHIRITEYSQHPSTPPPPEARTPDSEKPRIII
VAVRRSGRVRMHKSKENSSGTFSIGKTWNLDDLSQIESYTGPQVGLSYREWAGDTGFVVTLGKPYFWQAQTDKEK
KFFIASLVKIFGKYTGGKVPELTGFDQRELDQVLGAGRRPTAASVRSPGVESTVSSVASPSGLLPTPSSGAPEPS
RLPKPAAARPLNGTGSPAPSSDSVSSRDRVAAARWKSQDAEASPFGSRRDDASLTPRSRNGVVGPAASVRYGESR
ESSEPPQDVPSGPPSSHPEERPPPERRRPPMDPSRPQDRDLVPPPLVSPKSEPIRGAQGASTSPAAEAISPTEVS
ESPAPDDSQQDESRPGLGPMIKAKRSKGDIAGALWKAASAATAFRPRPGGAGDRLRLAQGKADGPDGITSVVPAP
SRPVSRDPRSEVTDAPNPADRDSNALKVDESTANASRAASIQPSAQPSPKDEKKREKKKEQKKEEEAVRSVVAGN
DVKYLQSLGIDPSVLDGRSEEFGQWLDHFGWVPGQQMRTQTMDDIKTDIERELNKAQAGGWLARFQEEDGRVDAI
KRGIDLAISECDEMDNLLTLYAVELSTLSEDIAYIEAQGQGLQVQTANQKLLRRELESLLETCAITSNDLEALRI
APLEKTRGLEDVESALVTLYRAMTKIDPTLGGHEATQTAGAEAGGTDQTVGLNNDYGNMRIAIRRGLCRDAALSG
RRHGEDGRRVLIRRRQRPAVEIQPTDADKSHPLYMGQMQSMVAILRRNARKPTGDEADLLFSSQSEKHQEGGVAT
TARKLTVKRSQTLARALRSPLDGRAPTADKVNREGGCHSYEVFSTALDEVLPLVEMEQNFIIDFFHATTLEQVDF
PDAVAVCPPRDRRGGNLGQHRLMEPDRDLARRVTRSMEVIFAFLESELQRLMDWVIGQDALQGVGVLAVLEKKLL
EMSRSNQDYVNTLLQKLHVVLEQRFKKFVDEQIRAIEETKVKVNKRKGVISFIRVFPAFSSAIENMMAGQEANMA
LRRTVDREYERILKSMFDSLMVIAREHPAGGATSGGVDPEDKEALNFHILLIENMNHFMEETETRGLELLEEWKE
QAQTTYDEHMGLYINAVMRRPLGKLLDQLENIEAQLQMGKLPEAIARQPSNSSATFSKVLGSYESKEVRKGIEAL
RKRVEKHFGDADDPALSRGLVLKVTRECEQFYNQVESRIGRVTTDVYGGEVPFEWPRAEVKGAFR
Coding >Ophio5|5494
ATGGACCGCGTCAACGGAGCCTCGGCTGCCGCCTCGCGGGCGGAACGCTTCGAGGATGAAAAGCGCCGCATCATC
GAAAGCTGCTTCAACAAGAGGGAGCCTGACGGCTCACTCATCGAGACATACATCACACACATACGAATCACCGAA
TACTCCCAACATCCTTCGACACCGCCGCCGCCAGAGGCACGAACCCCCGACTCGGAGAAGCCGCGAATCATCATC
GTGGCCGTCCGCAGATCGGGCCGCGTGCGCATGCACAAGTCCAAGGAGAATTCCTCCGGCACCTTCTCCATAGGC
AAGACCTGGAACCTCGACGACCTCAGCCAGATTGAGTCCTATACCGGCCCCCAAGTCGGCCTCAGCTACCGCGAA
TGGGCTGGCGACACGGGCTTTGTCGTTACGCTCGGGAAGCCCTACTTCTGGCAGGCACAGACGGACAAGGAGAAG
AAGTTCTTCATCGCCAGCCTCGTCAAGATCTTTGGGAAATACACGGGCGGAAAGGTCCCCGAGCTGACGGGCTTC
GACCAGAGGGAGCTGGATCAAGTCTTGGGCGCTGGCCGCCGTCCGACTGCTGCCTCGGTGCGGTCGCCGGGTGTC
GAGTCGACCGTCTCCTCGGTGGCATCGCCGTCAGGTCTTTTGCCTACGCCCTCCTCGGGCGCTCCCGAGCCGTCG
CGTTTACCCAAGCCGGCAGCCGCTCGACCCCTAAACGGAACCGGATCCCCTGCCCCGAGCTCCGATTCTGTCTCC
TCGAGGGATCGAGTGGCCGCGGCGCGGTGGAAGAGTCAGGACGCCGAGGCCAGCCCTTTCGGCTCGAGGCGCGAT
GATGCCAGCCTCACGCCCCGCTCTCGCAATGGCGTAGTCGGCCCTGCCGCATCAGTACGATACGGCGAGTCGCGG
GAGTCCTCGGAGCCGCCCCAGGATGTCCCTTCCGGTCCACCCTCGTCGCACCCAGAGGAGCGGCCGCCCCCGGAG
AGGCGAAGACCGCCAATGGATCCGTCTCGCCCACAGGATCGGGACCTAGTCCCACCGCCACTGGTCTCTCCCAAG
TCGGAGCCGATCCGCGGCGCTCAAGGAGCTTCGACTTCGCCCGCGGCCGAGGCCATCTCCCCGACAGAGGTGTCC
GAGTCTCCCGCCCCGGACGACTCCCAGCAAGACGAATCCCGCCCCGGGCTTGGTCCCATGATCAAGGCCAAACGG
TCCAAGGGGGACATCGCCGGTGCGCTCTGGAAAGCCGCCTCAGCAGCTACCGCTTTCCGTCCACGTCCCGGCGGC
GCAGGAGACCGGCTCCGTCTGGCACAAGGCAAAGCAGACGGCCCAGATGGCATCACGAGCGTCGTGCCGGCTCCC
TCGCGACCAGTGTCTCGCGACCCGAGATCGGAAGTGACGGATGCGCCGAATCCGGCGGATCGTGATTCCAACGCC
CTCAAGGTCGATGAATCGACGGCGAACGCTAGCCGTGCAGCAAGTATTCAGCCAAGCGCTCAGCCGTCGCCAAAG
GATGAGAAGAAGAGAGAGAAAAAGAAGGAGCAAAAGAAGGAGGAGGAAGCTGTGCGGTCGGTCGTTGCCGGCAAT
GATGTCAAGTACCTCCAGTCGCTCGGTATCGATCCGAGTGTCTTGGATGGCAGAAGCGAGGAGTTTGGACAGTGG
CTCGATCATTTCGGCTGGGTGCCTGGTCAGCAGATGCGCACGCAGACCATGGACGACATCAAGACGGACATTGAG
AGGGAGCTTAACAAGGCTCAGGCCGGTGGCTGGCTTGCCCGATTTCAGGAAGAGGACGGGAGAGTAGATGCCATC
AAGCGAGGTATCGACTTGGCGATCTCCGAGTGCGACGAGATGGATAATCTGCTCACGCTGTATGCGGTCGAGCTA
TCGACGCTTTCCGAAGATATAGCATACATCGAGGCCCAAGGGCAGGGCCTTCAGGTGCAGACGGCCAACCAAAAA
CTCCTCCGGCGAGAGCTCGAATCTCTACTCGAGACGTGCGCCATCACATCCAACGATCTCGAGGCGCTGCGGATC
GCGCCTCTGGAGAAGACGCGCGGGCTGGAAGATGTCGAGTCGGCGCTGGTGACGCTCTATCGAGCCATGACAAAA
ATAGATCCGACGCTCGGGGGCCACGAGGCTACTCAGACGGCCGGAGCCGAAGCCGGCGGCACGGACCAGACCGTC
GGACTCAACAACGACTACGGCAACATGAGAATCGCAATTCGACGAGGCCTTTGCCGAGACGCAGCGCTGTCTGGA
CGGCGCCATGGCGAAGACGGGCGACGCGTCCTCATACGACGCCGGCAGAGACCTGCTGTGGAGATACAGCCCACT
GATGCTGACAAGAGCCACCCGCTGTACATGGGCCAGATGCAAAGCATGGTGGCGATACTGCGGCGCAATGCGCGG
AAGCCGACGGGCGACGAGGCGGACCTTCTCTTCTCGTCGCAGTCGGAGAAGCATCAGGAGGGCGGGGTGGCGACG
ACGGCGCGGAAGCTGACGGTCAAGAGGAGCCAGACGTTGGCTAGGGCCTTGCGGTCGCCGCTCGACGGCCGGGCG
CCGACGGCCGACAAGGTGAACCGCGAAGGCGGGTGCCACTCATACGAGGTCTTCTCGACGGCGCTGGACGAGGTG
CTGCCGCTGGTAGAAATGGAGCAGAACTTCATCATCGACTTTTTCCACGCGACGACATTGGAGCAGGTCGACTTT
CCCGACGCGGTTGCGGTGTGCCCGCCTCGTGATCGGCGCGGGGGGAACCTCGGACAGCATCGTCTCATGGAGCCG
GACCGCGACCTGGCGAGACGAGTCACGCGCTCGATGGAAGTAATATTCGCCTTTCTCGAGTCGGAGCTGCAGAGG
CTGATGGACTGGGTGATTGGACAAGATGCCCTGCAAGGGGTTGGCGTGCTCGCGGTGCTGGAGAAGAAGCTGCTG
GAAATGAGCCGGTCGAACCAGGACTACGTCAACACGCTACTGCAGAAGCTTCACGTGGTGCTGGAGCAGCGGTTC
AAAAAGTTTGTCGACGAGCAGATCCGGGCCATCGAGGAGACCAAGGTCAAGGTCAACAAGCGCAAAGGGGTGATT
TCGTTCATCCGCGTCTTCCCCGCCTTCTCGTCGGCGATTGAGAACATGATGGCAGGACAGGAGGCCAACATGGCG
CTGCGACGGACGGTGGACCGCGAGTACGAGCGGATCCTCAAGTCCATGTTCGACTCGCTCATGGTGATCGCGCGG
GAGCATCCGGCGGGCGGAGCGACGAGCGGAGGGGTGGACCCGGAAGACAAGGAGGCGCTCAACTTTCACATCCTG
CTCATCGAGAACATGAACCACTTCATGGAGGAGACGGAGACGCGCGGGCTGGAGCTGCTGGAGGAGTGGAAGGAG
CAGGCTCAGACGACGTACGACGAGCACATGGGCCTGTACATCAACGCGGTGATGCGCAGGCCGCTGGGCAAGCTC
CTGGACCAGCTGGAGAACATCGAGGCGCAGCTGCAGATGGGCAAGCTGCCGGAGGCGATTGCGCGGCAGCCGTCC
AACAGCAGCGCGACGTTTAGCAAGGTGCTGGGCTCGTACGAGTCCAAGGAGGTGCGTAAGGGCATCGAGGCGCTG
CGCAAGCGGGTGGAGAAGCACTTTGGCGACGCCGACGATCCGGCGCTGAGCCGCGGGCTGGTGCTCAAGGTGACG
AGGGAGTGCGAGCAGTTTTACAACCAGGTCGAGAGCCGGATAGGGCGGGTGACGACGGATGTGTACGGGGGGGAG
GTGCCGTTTGAGTGGCCGAGGGCCGAGGTCAAGGGGGCCTTTCGC
Transcript >Ophio5|5494
ATGGACCGCGTCAACGGAGCCTCGGCTGCCGCCTCGCGGGCGGAACGCTTCGAGGATGAAAAGCGCCGCATCATC
GAAAGCTGCTTCAACAAGAGGGAGCCTGACGGCTCACTCATCGAGACATACATCACACACATACGAATCACCGAA
TACTCCCAACATCCTTCGACACCGCCGCCGCCAGAGGCACGAACCCCCGACTCGGAGAAGCCGCGAATCATCATC
GTGGCCGTCCGCAGATCGGGCCGCGTGCGCATGCACAAGTCCAAGGAGAATTCCTCCGGCACCTTCTCCATAGGC
AAGACCTGGAACCTCGACGACCTCAGCCAGATTGAGTCCTATACCGGCCCCCAAGTCGGCCTCAGCTACCGCGAA
TGGGCTGGCGACACGGGCTTTGTCGTTACGCTCGGGAAGCCCTACTTCTGGCAGGCACAGACGGACAAGGAGAAG
AAGTTCTTCATCGCCAGCCTCGTCAAGATCTTTGGGAAATACACGGGCGGAAAGGTCCCCGAGCTGACGGGCTTC
GACCAGAGGGAGCTGGATCAAGTCTTGGGCGCTGGCCGCCGTCCGACTGCTGCCTCGGTGCGGTCGCCGGGTGTC
GAGTCGACCGTCTCCTCGGTGGCATCGCCGTCAGGTCTTTTGCCTACGCCCTCCTCGGGCGCTCCCGAGCCGTCG
CGTTTACCCAAGCCGGCAGCCGCTCGACCCCTAAACGGAACCGGATCCCCTGCCCCGAGCTCCGATTCTGTCTCC
TCGAGGGATCGAGTGGCCGCGGCGCGGTGGAAGAGTCAGGACGCCGAGGCCAGCCCTTTCGGCTCGAGGCGCGAT
GATGCCAGCCTCACGCCCCGCTCTCGCAATGGCGTAGTCGGCCCTGCCGCATCAGTACGATACGGCGAGTCGCGG
GAGTCCTCGGAGCCGCCCCAGGATGTCCCTTCCGGTCCACCCTCGTCGCACCCAGAGGAGCGGCCGCCCCCGGAG
AGGCGAAGACCGCCAATGGATCCGTCTCGCCCACAGGATCGGGACCTAGTCCCACCGCCACTGGTCTCTCCCAAG
TCGGAGCCGATCCGCGGCGCTCAAGGAGCTTCGACTTCGCCCGCGGCCGAGGCCATCTCCCCGACAGAGGTGTCC
GAGTCTCCCGCCCCGGACGACTCCCAGCAAGACGAATCCCGCCCCGGGCTTGGTCCCATGATCAAGGCCAAACGG
TCCAAGGGGGACATCGCCGGTGCGCTCTGGAAAGCCGCCTCAGCAGCTACCGCTTTCCGTCCACGTCCCGGCGGC
GCAGGAGACCGGCTCCGTCTGGCACAAGGCAAAGCAGACGGCCCAGATGGCATCACGAGCGTCGTGCCGGCTCCC
TCGCGACCAGTGTCTCGCGACCCGAGATCGGAAGTGACGGATGCGCCGAATCCGGCGGATCGTGATTCCAACGCC
CTCAAGGTCGATGAATCGACGGCGAACGCTAGCCGTGCAGCAAGTATTCAGCCAAGCGCTCAGCCGTCGCCAAAG
GATGAGAAGAAGAGAGAGAAAAAGAAGGAGCAAAAGAAGGAGGAGGAAGCTGTGCGGTCGGTCGTTGCCGGCAAT
GATGTCAAGTACCTCCAGTCGCTCGGTATCGATCCGAGTGTCTTGGATGGCAGAAGCGAGGAGTTTGGACAGTGG
CTCGATCATTTCGGCTGGGTGCCTGGTCAGCAGATGCGCACGCAGACCATGGACGACATCAAGACGGACATTGAG
AGGGAGCTTAACAAGGCTCAGGCCGGTGGCTGGCTTGCCCGATTTCAGGAAGAGGACGGGAGAGTAGATGCCATC
AAGCGAGGTATCGACTTGGCGATCTCCGAGTGCGACGAGATGGATAATCTGCTCACGCTGTATGCGGTCGAGCTA
TCGACGCTTTCCGAAGATATAGCATACATCGAGGCCCAAGGGCAGGGCCTTCAGGTGCAGACGGCCAACCAAAAA
CTCCTCCGGCGAGAGCTCGAATCTCTACTCGAGACGTGCGCCATCACATCCAACGATCTCGAGGCGCTGCGGATC
GCGCCTCTGGAGAAGACGCGCGGGCTGGAAGATGTCGAGTCGGCGCTGGTGACGCTCTATCGAGCCATGACAAAA
ATAGATCCGACGCTCGGGGGCCACGAGGCTACTCAGACGGCCGGAGCCGAAGCCGGCGGCACGGACCAGACCGTC
GGACTCAACAACGACTACGGCAACATGAGAATCGCAATTCGACGAGGCCTTTGCCGAGACGCAGCGCTGTCTGGA
CGGCGCCATGGCGAAGACGGGCGACGCGTCCTCATACGACGCCGGCAGAGACCTGCTGTGGAGATACAGCCCACT
GATGCTGACAAGAGCCACCCGCTGTACATGGGCCAGATGCAAAGCATGGTGGCGATACTGCGGCGCAATGCGCGG
AAGCCGACGGGCGACGAGGCGGACCTTCTCTTCTCGTCGCAGTCGGAGAAGCATCAGGAGGGCGGGGTGGCGACG
ACGGCGCGGAAGCTGACGGTCAAGAGGAGCCAGACGTTGGCTAGGGCCTTGCGGTCGCCGCTCGACGGCCGGGCG
CCGACGGCCGACAAGGTGAACCGCGAAGGCGGGTGCCACTCATACGAGGTCTTCTCGACGGCGCTGGACGAGGTG
CTGCCGCTGGTAGAAATGGAGCAGAACTTCATCATCGACTTTTTCCACGCGACGACATTGGAGCAGGTCGACTTT
CCCGACGCGGTTGCGGTGTGCCCGCCTCGTGATCGGCGCGGGGGGAACCTCGGACAGCATCGTCTCATGGAGCCG
GACCGCGACCTGGCGAGACGAGTCACGCGCTCGATGGAAGTAATATTCGCCTTTCTCGAGTCGGAGCTGCAGAGG
CTGATGGACTGGGTGATTGGACAAGATGCCCTGCAAGGGGTTGGCGTGCTCGCGGTGCTGGAGAAGAAGCTGCTG
GAAATGAGCCGGTCGAACCAGGACTACGTCAACACGCTACTGCAGAAGCTTCACGTGGTGCTGGAGCAGCGGTTC
AAAAAGTTTGTCGACGAGCAGATCCGGGCCATCGAGGAGACCAAGGTCAAGGTCAACAAGCGCAAAGGGGTGATT
TCGTTCATCCGCGTCTTCCCCGCCTTCTCGTCGGCGATTGAGAACATGATGGCAGGACAGGAGGCCAACATGGCG
CTGCGACGGACGGTGGACCGCGAGTACGAGCGGATCCTCAAGTCCATGTTCGACTCGCTCATGGTGATCGCGCGG
GAGCATCCGGCGGGCGGAGCGACGAGCGGAGGGGTGGACCCGGAAGACAAGGAGGCGCTCAACTTTCACATCCTG
CTCATCGAGAACATGAACCACTTCATGGAGGAGACGGAGACGCGCGGGCTGGAGCTGCTGGAGGAGTGGAAGGAG
CAGGCTCAGACGACGTACGACGAGCACATGGGCCTGTACATCAACGCGGTGATGCGCAGGCCGCTGGGCAAGCTC
CTGGACCAGCTGGAGAACATCGAGGCGCAGCTGCAGATGGGCAAGCTGCCGGAGGCGATTGCGCGGCAGCCGTCC
AACAGCAGCGCGACGTTTAGCAAGGTGCTGGGCTCGTACGAGTCCAAGGAGGTGCGTAAGGGCATCGAGGCGCTG
CGCAAGCGGGTGGAGAAGCACTTTGGCGACGCCGACGATCCGGCGCTGAGCCGCGGGCTGGTGCTCAAGGTGACG
AGGGAGTGCGAGCAGTTTTACAACCAGGTCGAGAGCCGGATAGGGCGGGTGACGACGGATGTGTACGGGGGGGAG
GTGCCGTTTGAGTGGCCGAGGGCCGAGGTCAAGGGGGCCTTTCGCTGA
Gene >Ophio5|5494
ATGGACCGCGTCAACGGAGCCTCGGCTGCCGCCTCGCGGGCGGAACGCTTCGAGGATGAAAAGCGCCGCATCATC
GAAAGCTGCTTCAACAAGAGGGAGCCTGACGGCTCACGTAAGTCTACTGCCCTCGTTACCCTTGCAGATCTATCA
TGGTCCCGTGGCGCTGCTTCTGGGAACTCTTGTCGAGCGACGATGGAGGGAAAAGTGACTGACCACTCTGTGCTC
TCCACGTAGTCATCGAGACATACATCACACACATACGAATCACCGAATACTCCCAACATCCTTCGACACCGCCGC
CGCCAGAGGCACGAACCCCCGACTCGGAGAAGCCGCGAATCATCATCGTGGCCGTCCGCAGATCGGGCCGCGTGC
GCATGCACAAGTCCAAGGAGAATTCCTCCGGCACCTTCTCCATAGGCAAGACCTGGAACCTCGACGACCTCAGCC
AGATTGAGTCCTATACCGGCCCCCAAGTCGGCCTCAGCTACCGCGAATGGGCTGGCGACACGGGCTTTGTCGTTA
CGCTCGGGAAGCCCTACTTCTGGCAGGCACAGACGGACAAGGAGAAGAAGTTCTTCATCGCCAGCCTCGTCAAGA
TCTTTGGGAAATACACGGGCGGAAAGGTCCCCGAGCTGACGGGCTTCGACCAGAGGGAGCTGGATCAAGTCTTGG
GCGCTGGCCGCCGTCCGACTGCTGCCTCGGTGCGGTCGCCGGGTGTCGAGTCGACCGTCTCCTCGGTGGCATCGC
CGTCAGGTCTTTTGCCTACGCCCTCCTCGGGCGCTCCCGAGCCGTCGCGTTTACCCAAGCCGGCAGCCGCTCGAC
CCCTAAACGGAACCGGATCCCCTGCCCCGAGCTCCGATTCTGTCTCCTCGAGGGATCGAGTGGCCGCGGCGCGGT
GGAAGAGTCAGGACGCCGAGGCCAGCCCTTTCGGCTCGAGGCGCGATGATGCCAGCCTCACGCCCCGCTCTCGCA
ATGGCGTAGTCGGCCCTGCCGCATCAGTACGATACGGCGAGTCGCGGGAGTCCTCGGAGCCGCCCCAGGATGTCC
CTTCCGGTCCACCCTCGTCGCACCCAGAGGAGCGGCCGCCCCCGGAGAGGCGAAGACCGCCAATGGATCCGTCTC
GCCCACAGGATCGGGACCTAGTCCCACCGCCACTGGTGAGCCCCCTCACTAGGAGCGAGCCCCTCCCGCCGCCCC
CGAAGAGCAAGGGACGCTCGTCCAGTGGCAAGGACGACGGCCCTGGTCGGTCTTCGGGCGCGCGCAGGGATCAGA
ATGTTGAGCCCCCCATTGTGTCAACTTTGGGTACTGACGTGAGGGAGGTCTCTCCCAAGTCGGAGCCGATCCGCG
GCGCTCAAGGAGCTTCGACTTCGCCCGCGGCCGAGGCCATCTCCCCGACAGAGGTGTCCGAGTCTCCCGCCCCGG
ACGACTCCCAGCAAGACGAATCCCGCCCCGGGCTTGGTCCCATGATCAAGGCCAAACGGTCCAAGGGGGACATCG
CCGGTGCGCTCTGGAAAGCCGCCTCAGCAGCTACCGCTTTCCGTCCACGTCCCGGCGGCGCAGGAGACCGGCTCC
GTCTGGCACAAGGCAAAGCAGACGGCCCAGATGGCATCACGAGCGTCGTGCCGGCTCCCTCGCGACCAGTGTCTC
GCGACCCGAGATCGGAAGTGACGGATGCGCCGAATCCGGCGGATCGTGATTCCAACGCCCTCAAGGTCGATGAAT
CGACGGCGAACGCTAGCCGTGCAGCAAGTATTCAGCCAAGCGCTCAGCCGTCGCCAAAGGATGAGAAGAAGAGAG
AGAAAAAGAAGGAGCAAAAGAAGGAGGAGGAAGCTGTGCGGTCGGTCGTTGCCGGCAATGATGTCAAGTACCTCC
AGTCGCTCGGTATCGATCCGAGTGTCTTGGATGGCAGAAGCGAGGAGTTTGGACAGTGGCTCGATCATTTCGGCT
GGGTGCCTGGTCAGCAGATGCGCACGCAGACCATGGACGACATCAAGACGGACATTGAGAGGGAGCTTAACAAGG
CTCAGGCCGGTGGCTGGCTTGCCCGATTTCAGGAAGAGGACGGGAGAGTAGATGCCATCAAGCGAGGTATCGACT
TGGCGATCTCCGAGTGCGACGAGATGGATAATCTGCTCACGCTGTATGCGGTCGAGCTATCGGTAAGTTGCGGGA
CACCAAACTCCAGACGACACGTCGACTGACGTGTGCCACAGACGCTTTCCGAAGATATAGCATACATCGAGGCCC
AAGGGCAGGGCCTTCAGGTGCAGACGGCCAACCAAAAACTCCTCCGGCGAGAGCTCGAATCTCTACTCGAGACGT
GCGCCATCACATCCAACGATCTCGAGGCGCTGCGGATCGCGCCTCTGGAGAAGACGCGCGGGCTGGAAGATGTCG
AGTCGGCGCTGGTGACGCTCTATCGAGCCATGACAAAAATAGATCCGACGCTCGGGGGCCACGAGGCTACTCAGA
CGGCCGGAGCCGAAGCCGGCGGCACGGACCAGACCGTCGGACTCAACAACGACTACGGCAACATGAGAATCGTAC
GTGAGAAGAAGCAGACGTACCAGCAAGAGAGCGCCTACTTCATGCGGCGGCTCATCGATTTCATGAACAGGCAAT
TCGACGAGGCCTTTGCCGAGACGCAGCGCTGTCTGGACGGCGCCATGGCGAAGACGGGCGACGCGTCCTCATACG
ACGCCGGCAGAGACCTGCTGTGGAGATACAGCCCACTGATGCTGTACGCGCGAGATGTCGAACTGGAAAACTGGA
ACCGGCTGCTCCAGATCTATCAGGACAAGAGCCACCCGCTGTACATGGGCCAGATGCAAAGCATGGTGGCGATAC
TGCGGCGCAATGCGCGGAAGCCGACGGGCGACGAGGCGGACCTTCTCTTCTCGTCGCAGTCGGAGAAGCATCAGG
AGGGCGGGGTGGCGACGACGGCGCGGAAGCTGACGGTCAAGAGGAGCCAGACGTTGGCTAGGGCCTTGCGGTCGC
CGCTCGACGGCCGGGCGCCGACGGCCGACAAGGTGAACCGCGAAGGCGGGTGCCACTCATACGAGGTCTTCTCGA
CGGCGCTGGACGAGGTGCTGCCGCTGGTAGAAATGGAGCAGAACTTCATCATCGACTTTTTCCACGCGACGACAT
TGGAGCAGGTCGACTTTCCCGACGCGGTTGCGGTGTGCCCGCCTCGTGATCGGCGCGGGGGGAACCTCGGACAGC
ATCGTCTCATGGAGCCGGACCGCGACCTGGCGAGACGAGTCACGCGCTCGATGGAAGTAATATTCGCCTTTCTCG
AGTCGGAGCTGCAGAGGCTGATGGACTGGGTGATTGGACAAGATGCCCTGTAAGCAACTGTCTTGTCTCTCTCTC
GTCACCCCCCCTATTCCGGCGCGAGGCTAACGGGGAAGCAGGCAAGGGGTTGGCGTGCTCGCGGTGCTGGAGAAG
AAGCTGCTGGAAATGAGCCGGTCGAACCAGGACTACGTCAACACGCTACTGCAGAAGCTTCACGTGGTGCTGGAG
CAGCGGTTCAAAAAGTTTGTCGACGAGCAGATCCGGGCCATCGAGGAGACCAAGGTCAAGGTCAACAAGCGCAAA
GGGGTGATTTCGTTCATCCGCGTCTTCCCCGCCTTCTCGTCGGCGATTGAGAACATGATGGCAGGACAGGAGGCC
AACATGGCGCTGCGACGGACGGTGGACCGCGAGTACGAGCGGATCCTCAAGTCCATGTTCGACTCGCTCATGGTG
ATCGCGCGGGAGCATCCGGCGGGCGGAGCGACGAGCGGAGGGGTGGACCCGGAAGACAAGGAGGCGCTCAACTTT
CACATCCTGCTCATCGAGAACATGAACCACTTCATGGAGGAGACGGAGACGCGCGGGCTGGAGCTGCTGGAGGAG
TGGAAGGAGCAGGCTCAGACGACGTACGACGAGCACATGGGCCTGTACATCAACGCGGTGATGCGCAGGCCGCTG
GGCAAGCTCCTGGACCAGCTGGAGAACATCGAGGCGCAGCTGCAGATGGGCAAGCTGCCGGAGGCGATTGCGCGG
CAGCCGTCCAACAGCAGCGCGACGTTTAGCAAGGTGCTGGGCTCGTACGAGTCCAAGGAGGTGCGTAAGGGCATC
GAGGCGCTGCGCAAGCGGGTGGAGAAGCACTTTGGCGACGCCGACGATCCGGCGCTGAGCCGCGGGCTGGTGCTC
AAGGTGACGAGGGAGTGCGAGCAGTTTTACAACCAGGTCGAGAGCCGGATAGGGCGGGTGACGACGGATGTGTAC
GGGGGGGAGGTGCCGTTTGAGTGGCCGAGGGCCGAGGTCAAGGGGGCCTTTCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail