Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5492
Gene name
Locationscaffold_45:38649..45432
Strand+
Gene length (bp)6783
Transcript length (bp)5751
Coding sequence length (bp)5748
Protein length (aa) 1916

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00632 HECT HECT-domain (ubiquitin-transferase) 1.7E-72 1568 1916

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10435|YDE1_SCHPO Probable ubiquitin fusion degradation protein C12B10.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.01c PE=3 SV=2 1309 1916 5.0E-136
sp|P33202|UFD4_YEAST Ubiquitin fusion degradation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UFD4 PE=1 SV=1 1309 1916 7.0E-133
sp|Q6WWW4|UPL3_ARATH E3 ubiquitin-protein ligase UPL3 OS=Arabidopsis thaliana GN=UPL3 PE=1 SV=1 1382 1916 1.0E-111
sp|Q14669|TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens GN=TRIP12 PE=1 SV=1 1310 1916 9.0E-110
sp|E1B7Q7|TRIPC_BOVIN E3 ubiquitin-protein ligase TRIP12 OS=Bos taurus GN=TRIP12 PE=2 SV=2 1310 1916 1.0E-109
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10435|YDE1_SCHPO Probable ubiquitin fusion degradation protein C12B10.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.01c PE=3 SV=2 1309 1916 5.0E-136
sp|P33202|UFD4_YEAST Ubiquitin fusion degradation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UFD4 PE=1 SV=1 1309 1916 7.0E-133
sp|Q6WWW4|UPL3_ARATH E3 ubiquitin-protein ligase UPL3 OS=Arabidopsis thaliana GN=UPL3 PE=1 SV=1 1382 1916 1.0E-111
sp|Q14669|TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens GN=TRIP12 PE=1 SV=1 1310 1916 9.0E-110
sp|E1B7Q7|TRIPC_BOVIN E3 ubiquitin-protein ligase TRIP12 OS=Bos taurus GN=TRIP12 PE=2 SV=2 1310 1916 1.0E-109
sp|F1LP64|TRIPC_RAT E3 ubiquitin-protein ligase TRIP12 OS=Rattus norvegicus GN=Trip12 PE=1 SV=1 1310 1916 3.0E-109
sp|G5E870|TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus GN=Trip12 PE=1 SV=1 1310 1916 1.0E-108
sp|B4F6W9|TRIPC_XENTR E3 ubiquitin-protein ligase TRIP12 OS=Xenopus tropicalis GN=trip12 PE=2 SV=1 1310 1916 2.0E-108
sp|F1RCR6|TRIPC_DANRE E3 ubiquitin-protein ligase TRIP12 OS=Danio rerio GN=trip12 PE=3 SV=1 1310 1916 3.0E-108
sp|Q9LYZ7|UPL4_ARATH E3 ubiquitin-protein ligase UPL4 OS=Arabidopsis thaliana GN=UPL4 PE=3 SV=1 1402 1916 2.0E-96
sp|Q14669|TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens GN=TRIP12 PE=1 SV=1 97 732 2.0E-68
sp|E1B7Q7|TRIPC_BOVIN E3 ubiquitin-protein ligase TRIP12 OS=Bos taurus GN=TRIP12 PE=2 SV=2 97 732 7.0E-68
sp|Q6WWW4|UPL3_ARATH E3 ubiquitin-protein ligase UPL3 OS=Arabidopsis thaliana GN=UPL3 PE=1 SV=1 258 729 1.0E-66
sp|F1RCR6|TRIPC_DANRE E3 ubiquitin-protein ligase TRIP12 OS=Danio rerio GN=trip12 PE=3 SV=1 94 732 3.0E-64
sp|B4F6W9|TRIPC_XENTR E3 ubiquitin-protein ligase TRIP12 OS=Xenopus tropicalis GN=trip12 PE=2 SV=1 97 732 6.0E-56
sp|Q10435|YDE1_SCHPO Probable ubiquitin fusion degradation protein C12B10.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.01c PE=3 SV=2 207 729 5.0E-55
sp|G5E870|TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus GN=Trip12 PE=1 SV=1 97 732 6.0E-55
sp|F1LP64|TRIPC_RAT E3 ubiquitin-protein ligase TRIP12 OS=Rattus norvegicus GN=Trip12 PE=1 SV=1 97 732 2.0E-54
sp|Q9LYZ7|UPL4_ARATH E3 ubiquitin-protein ligase UPL4 OS=Arabidopsis thaliana GN=UPL4 PE=3 SV=1 256 737 2.0E-42
sp|Q69ZR2|HECD1_MOUSE E3 ubiquitin-protein ligase HECTD1 OS=Mus musculus GN=Hectd1 PE=1 SV=2 1395 1657 6.0E-38
sp|Q9ULT8|HECD1_HUMAN E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens GN=HECTD1 PE=1 SV=3 1395 1657 7.0E-38
sp|P33202|UFD4_YEAST Ubiquitin fusion degradation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UFD4 PE=1 SV=1 280 1058 6.0E-36
sp|Q9ULT8|HECD1_HUMAN E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens GN=HECTD1 PE=1 SV=3 1664 1916 3.0E-35
sp|Q69ZR2|HECD1_MOUSE E3 ubiquitin-protein ligase HECTD1 OS=Mus musculus GN=Hectd1 PE=1 SV=2 1664 1916 2.0E-32
sp|Q8H0T4|UPL2_ARATH E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis thaliana GN=UPL2 PE=1 SV=3 1493 1913 3.0E-23
sp|Q9P4Z1|TOM1_NEUCR E3 ubiquitin-protein ligase TOM1-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B11B22.010 PE=3 SV=4 1559 1913 3.0E-23
sp|P53119|HUL5_YEAST Probable E3 ubiquitin-protein ligase HUL5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HUL5 PE=1 SV=1 1467 1916 7.0E-23
sp|O13834|PTR1_SCHPO E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr1 PE=1 SV=1 1592 1913 7.0E-23
sp|Q8GY23|UPL1_ARATH E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana GN=UPL1 PE=1 SV=3 1493 1913 1.0E-22
sp|Q8RWB8|UPL6_ARATH E3 ubiquitin-protein ligase UPL6 OS=Arabidopsis thaliana GN=UPL6 PE=2 SV=1 1514 1916 2.0E-22
sp|Q7Z6Z7|HUWE1_HUMAN E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens GN=HUWE1 PE=1 SV=3 1577 1916 7.0E-22
sp|Q96J02|ITCH_HUMAN E3 ubiquitin-protein ligase Itchy homolog OS=Homo sapiens GN=ITCH PE=1 SV=2 1565 1911 8.0E-22
sp|Q9Y0H4|SUDX_DROME E3 ubiquitin-protein ligase Su(dx) OS=Drosophila melanogaster GN=Su(dx) PE=1 SV=1 1565 1911 9.0E-22
sp|O00308|WWP2_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Homo sapiens GN=WWP2 PE=1 SV=2 1520 1911 9.0E-22
sp|Q7TMY8|HUWE1_MOUSE E3 ubiquitin-protein ligase HUWE1 OS=Mus musculus GN=Huwe1 PE=1 SV=5 1577 1916 9.0E-22
sp|Q8C863|ITCH_MOUSE E3 ubiquitin-protein ligase Itchy OS=Mus musculus GN=Itch PE=1 SV=2 1565 1911 2.0E-21
sp|Q9DBH0|WWP2_MOUSE NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Mus musculus GN=Wwp2 PE=1 SV=1 1520 1911 3.0E-21
sp|P51593|HUWE1_RAT E3 ubiquitin-protein ligase HUWE1 (Fragment) OS=Rattus norvegicus GN=Huwe1 PE=1 SV=2 1581 1916 6.0E-21
sp|Q756G2|TOM1_ASHGO Probable E3 ubiquitin-protein ligase TOM1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TOM1 PE=3 SV=2 1544 1916 7.0E-20
sp|Q9SCQ2|UPL7_ARATH E3 ubiquitin-protein ligase UPL7 OS=Arabidopsis thaliana GN=UPL7 PE=2 SV=1 1467 1916 1.0E-19
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 1619 1911 3.0E-19
sp|Q92462|PUB1_SCHPO E3 ubiquitin-protein ligase pub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pub1 PE=1 SV=2 1617 1911 9.0E-19
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 1619 1911 1.0E-18
sp|Q9H0M0|WWP1_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Homo sapiens GN=WWP1 PE=1 SV=1 1520 1911 1.0E-18
sp|Q8BZZ3|WWP1_MOUSE NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Mus musculus GN=Wwp1 PE=1 SV=2 1520 1911 2.0E-18
sp|Q03280|TOM1_YEAST E3 ubiquitin-protein ligase TOM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM1 PE=1 SV=1 1544 1916 3.0E-18
sp|Q5RBF2|NED4L_PONAB E3 ubiquitin-protein ligase NEDD4-like OS=Pongo abelii GN=NEDD4L PE=2 SV=1 1617 1911 7.0E-18
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 1546 1916 7.0E-18
sp|Q9VVI3|NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster GN=Nedd4 PE=1 SV=2 1520 1911 9.0E-18
sp|Q8CFI0|NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus GN=Nedd4l PE=1 SV=2 1617 1911 2.0E-17
sp|Q96PU5|NED4L_HUMAN E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens GN=NEDD4L PE=1 SV=2 1617 1911 2.0E-17
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 1348 1911 3.0E-17
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 1620 1911 6.0E-17
sp|Q1K9C4|YFK7_SCHPO Probable E3 ubiquitin protein ligase C167.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC167.07c PE=2 SV=1 1485 1911 6.0E-17
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 1581 1916 4.0E-16
sp|Q05086|UBE3A_HUMAN Ubiquitin-protein ligase E3A OS=Homo sapiens GN=UBE3A PE=1 SV=4 1620 1911 4.0E-16
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 1581 1916 5.0E-16
sp|Q5BDP1|RSP5_EMENI E3 ubiquitin-protein ligase RSP5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hulA PE=1 SV=1 1617 1911 6.0E-16
sp|Q0CCL1|RSP5_ASPTN Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hulA PE=3 SV=1 1617 1911 7.0E-16
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 1581 1916 1.0E-15
sp|A1D3C5|RSP5_NEOFI Probable E3 ubiquitin-protein ligase hulA OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hulA PE=3 SV=1 1617 1911 1.0E-15
sp|A1CQG2|RSP5_ASPCL Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hulA PE=3 SV=2 1617 1911 1.0E-15
sp|Q4WTF3|RSP5_ASPFU Probable E3 ubiquitin-protein ligase hulA OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hulA PE=3 SV=2 1617 1911 2.0E-15
sp|B0XQ72|RSP5_ASPFC Probable E3 ubiquitin-protein ligase hulA OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=hulA PE=3 SV=2 1617 1911 2.0E-15
sp|A2A5Z6|SMUF2_MOUSE E3 ubiquitin-protein ligase SMURF2 OS=Mus musculus GN=Smurf2 PE=1 SV=1 1581 1911 2.0E-15
sp|O08759|UBE3A_MOUSE Ubiquitin-protein ligase E3A OS=Mus musculus GN=Ube3a PE=1 SV=2 1620 1911 3.0E-15
sp|P39940|RSP5_YEAST E3 ubiquitin-protein ligase RSP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSP5 PE=1 SV=1 1617 1911 3.0E-15
sp|A2QQ28|RSP5_ASPNC Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hulA PE=3 SV=1 1617 1911 5.0E-15
sp|Q8CHG5|AREL1_MOUSE Apoptosis-resistant E3 ubiquitin protein ligase 1 OS=Mus musculus GN=Arel1 PE=2 SV=2 1521 1913 5.0E-15
sp|Q2UBP1|RSP5_ASPOR Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hulA PE=3 SV=2 1617 1911 6.0E-15
sp|B8N7E5|RSP5_ASPFN Probable E3 ubiquitin-protein ligase hulA OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=hulA PE=3 SV=1 1617 1911 7.0E-15
sp|Q9HAU4|SMUF2_HUMAN E3 ubiquitin-protein ligase SMURF2 OS=Homo sapiens GN=SMURF2 PE=1 SV=1 1581 1911 8.0E-15
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 1546 1916 1.0E-14
sp|Q9HCE7|SMUF1_HUMAN E3 ubiquitin-protein ligase SMURF1 OS=Homo sapiens GN=SMURF1 PE=1 SV=2 1565 1911 2.0E-14
sp|Q9CUN6|SMUF1_MOUSE E3 ubiquitin-protein ligase SMURF1 OS=Mus musculus GN=Smurf1 PE=2 SV=2 1565 1911 2.0E-14
sp|Q9PUN2|SMUF1_XENLA E3 ubiquitin-protein ligase SMURF1 OS=Xenopus laevis GN=smurf1 PE=2 SV=1 1565 1911 2.0E-14
sp|P46935|NEDD4_MOUSE E3 ubiquitin-protein ligase NEDD4 OS=Mus musculus GN=Nedd4 PE=1 SV=3 1728 1911 2.0E-14
sp|A9JRZ0|SMUF2_DANRE E3 ubiquitin-protein ligase SMURF2 OS=Danio rerio GN=smurf2 PE=2 SV=1 1581 1911 2.0E-14
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 1546 1916 3.0E-14
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 1546 1916 3.0E-14
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 1546 1916 4.0E-14
sp|O15033|AREL1_HUMAN Apoptosis-resistant E3 ubiquitin protein ligase 1 OS=Homo sapiens GN=AREL1 PE=1 SV=3 1521 1913 6.0E-14
sp|Q62940|NEDD4_RAT E3 ubiquitin-protein ligase NEDD4 OS=Rattus norvegicus GN=Nedd4 PE=1 SV=1 1728 1911 1.0E-13
sp|Q80U95|UBE3C_MOUSE Ubiquitin-protein ligase E3C OS=Mus musculus GN=Ube3c PE=1 SV=2 1620 1916 1.0E-13
sp|Q9V853|SMUF1_DROME E3 ubiquitin-protein ligase Smurf1 OS=Drosophila melanogaster GN=lack PE=1 SV=3 1520 1911 2.0E-13
sp|Q2TAS2|SMUF2_XENLA E3 ubiquitin-protein ligase SMURF2 OS=Xenopus laevis GN=smurf2 PE=2 SV=1 1603 1911 3.0E-13
sp|O14326|PUB3_SCHPO E3 ubiquitin-protein ligase pub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pub3 PE=2 SV=1 1609 1911 3.0E-13
sp|Q15386|UBE3C_HUMAN Ubiquitin-protein ligase E3C OS=Homo sapiens GN=UBE3C PE=1 SV=3 1620 1916 3.0E-13
sp|Q8K4P8|HECW1_MOUSE E3 ubiquitin-protein ligase HECW1 OS=Mus musculus GN=Hecw1 PE=1 SV=3 1520 1908 4.0E-13
sp|P46934|NEDD4_HUMAN E3 ubiquitin-protein ligase NEDD4 OS=Homo sapiens GN=NEDD4 PE=1 SV=4 1728 1911 5.0E-13
sp|Q76N89|HECW1_HUMAN E3 ubiquitin-protein ligase HECW1 OS=Homo sapiens GN=HECW1 PE=1 SV=3 1520 1908 1.0E-12
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 1518 1911 2.0E-12
sp|Q6I6G8|HECW2_MOUSE E3 ubiquitin-protein ligase HECW2 OS=Mus musculus GN=Hecw2 PE=1 SV=1 1520 1908 3.0E-12
sp|Q9P2P5|HECW2_HUMAN E3 ubiquitin-protein ligase HECW2 OS=Homo sapiens GN=HECW2 PE=1 SV=2 1520 1908 4.0E-12
sp|Q9UTG2|PUB2_SCHPO E3 ubiquitin-protein ligase pub2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pub2 PE=1 SV=1 1620 1911 5.0E-12
sp|O94275|MUG30_SCHPO Probable E3 ubiquitin-protein ligase mug30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug30 PE=1 SV=1 1717 1911 1.0E-10
sp|Q5U5R9|HECD2_HUMAN Probable E3 ubiquitin-protein ligase HECTD2 OS=Homo sapiens GN=HECTD2 PE=2 SV=2 1729 1911 2.0E-10
sp|Q5RD78|HECD2_PONAB Probable E3 ubiquitin-protein ligase HECTD2 OS=Pongo abelii GN=HECTD2 PE=2 SV=1 1729 1911 2.0E-10
sp|Q10435|YDE1_SCHPO Probable ubiquitin fusion degradation protein C12B10.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.01c PE=3 SV=2 863 1085 3.0E-10
sp|Q8CDU6|HECD2_MOUSE Probable E3 ubiquitin-protein ligase HECTD2 OS=Mus musculus GN=Hectd2 PE=1 SV=2 1738 1911 4.0E-10
sp|Q9ES34|UBE3B_MOUSE Ubiquitin-protein ligase E3B OS=Mus musculus GN=Ube3b PE=1 SV=3 1568 1916 7.0E-10
sp|Q80TP3|UBR5_MOUSE E3 ubiquitin-protein ligase UBR5 OS=Mus musculus GN=Ubr5 PE=1 SV=2 1594 1913 1.0E-09
sp|O95071|UBR5_HUMAN E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens GN=UBR5 PE=1 SV=2 1594 1913 1.0E-09
sp|Q62671|UBR5_RAT E3 ubiquitin-protein ligase UBR5 OS=Rattus norvegicus GN=Ubr5 PE=1 SV=3 1594 1913 1.0E-09
sp|Q7Z3V4|UBE3B_HUMAN Ubiquitin-protein ligase E3B OS=Homo sapiens GN=UBE3B PE=1 SV=3 1568 1916 4.0E-09
sp|Q757T0|HUL4_ASHGO Probable E3 ubiquitin-protein ligase HUL4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HUL4 PE=3 SV=1 1732 1911 6.0E-09
sp|Q9UII4|HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 1581 1911 6.0E-09
sp|Q08CZ0|UBE3B_XENTR Ubiquitin-protein ligase E3B OS=Xenopus tropicalis GN=ube3b PE=2 SV=1 1568 1916 8.0E-09
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 1751 1906 3.0E-08
sp|P40985|HUL4_YEAST Probable E3 ubiquitin-protein ligase HUL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HUL4 PE=1 SV=2 1724 1911 7.0E-08
sp|P51592|HYD_DROME E3 ubiquitin-protein ligase hyd OS=Drosophila melanogaster GN=hyd PE=1 SV=3 1614 1913 3.0E-07
sp|Q9SU29|UPL5_ARATH E3 ubiquitin-protein ligase UPL5 OS=Arabidopsis thaliana GN=UPL5 PE=1 SV=1 1546 1902 4.0E-07
sp|F4JL11|IMPA2_ARATH Importin subunit alpha-2 OS=Arabidopsis thaliana GN=IMPA2 PE=1 SV=1 265 453 6.0E-07
sp|C6KTB7|ALTH1_PLAF7 Putative E3 ubiquitin-protein ligase protein PFF1365c OS=Plasmodium falciparum (isolate 3D7) GN=PFF1365c PE=3 SV=1 1617 1907 7.0E-07
sp|Q96321|IMPA1_ARATH Importin subunit alpha-1 OS=Arabidopsis thaliana GN=IMPA1 PE=1 SV=2 262 453 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004842 ubiquitin-protein transferase activity Yes
GO:0019787 ubiquitin-like protein transferase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5492
MAERTPAGENPERLASSPSTASAAGFQRITRSSARQAASQAAHTSDTLAATVSAPNSTVASQQPGRKRKVSSNES
SPQTTSRTSSTGRRSKRQKVPESAAPTPTGLTASLASRPRRKGKAPVDMDSQDGLPGTPGVPESTAEVSRKSSRS
KKSAPAGTESNSTSGLASRRPRRNANNVDDPDTTMSGTEENNDPGPPPPPPPPAEDDDSDDHEEEDEGGEERGRY
DGNDEDDPFGGFGGPGSGLSNTLRALTGMMTGLSGRLRELLNNLRQDDLSLQVIALQELSEILLVSNEDNLSGHF
SPDAFVKELVLLMNKEESPEVMLLACRCLANLMEALPASVANVVYGNAVPVLCQKLLEISFIDLAEQALSTLEKI
SAEYPSSIVREGGLTACLSYLDFFATSTQRTAVTTAANCCRNIPDDSFPVVKEVMPILLNVLGSSDQRVVEQASL
CVSGIVESFKYQSAKLEELVSVDLLRVVLRLLVPGTTNLIGSNIHTQFLRVLAFTARASPRLSAELFKLNIVETL
YHILTGVSPPSGTEDVASKLDSVVVMQALIHRPRDQIVETLNVICELLPSLPRNADPSFGDFVELASSTEPITPS
SVDGRSRRTPNDKRLELLEDCKEQVRRFALIIFPTLTDAFSSTVNLSVRQKVLTAQLKMLSNLDEVILSEALTPV
PYASFLASILSQRDHPSLVMLGLQATELLSSRLDNIYRYQLYREGVIYEINKLATEEESSQDLVNRNDDADKAAG
TSGGGGRGGDDASGCDSNEDEGNENADNDEGEAHDTSADDEDDEDEEDDEENGDNEHEPIPGDMSPASSRGSTMS
LDMPPHRYVSDVRSMKSRIRDVAKRFLENHESGGHGQAMKAEAAAILNALSDLAGELDAFYLKRTVANQVPRKGK
ELFLQLASYFDTDVLESVTSAELLASGLVRTLLDVFSNPDEELARAAQSTFLEVFMGRALKSRPKTTTAESPATP
FSVMIHKLQDLLSRSEHFEVITVHHNTFDGNRSSPASMLGKQIRLRMVADDESNIPRPYRNIMVSIHAIATFKSL
DDYLRPRISLAERPQNSRREGLARAFAAISGAGGLPLSSAAARLVDRSALAGGPTPPPPPPPPPPPAASTPSGSR
HSRRSKNRNASRSNEPSAPEQPGGSSRGKGALRRSSRRHAAPTDAALPPRPPPTEEDEPRSTLECADERQLTDDD
EAEDEAGALDAIVGELDEDMDDDDKSAPEPSAVNLEVATGGKITARKDDGTRVPTPAGSSLTTRSGDHSLSGSGR
GTPTPLTAAARPVPTPAAPMSYASALQAVPQDWHIEFSLDSKVIPNETTIYRAVHTSTSSNSEDLLSRSIWSATH
PIKFRRVPGPPPAESQGFGSNSDAEVDTVNGVPASLAKYPTTASILRLLNILHELNANIEDILAENRNTVVSINT
EPPSQFVNTKLTAKLNRQLEEPLIVASSCLPSWSEDLARLYPFLFPFETRHLFLQSTSFGYARSMARWQNAQSAD
DNRRDRNNDRPFLGRLQRQKVRISRLKILESALKVMDLYGASQSILEVEYFEEVGTGLGPTLEFYSTVSREFSKK
KLKLWREVDSSMSAEFVSGQAGLFPRPLSPEELSSPNGERILHLFKMLGKFVARSMIDSRIIDIHFNPIFFRIGD
TPSTGVKPSLGAVKLVDPGLARSLKAIKNFSLAKKEIDEDPGRSPAQKVADTTNLTVDNVRLEDMCLDFTLPGYP
NIELEVNGSHNRVTMENVDLYLDRVIDMTLGFGVRRQVDAFRTGFSQVFPYSALSAFTPDELVSLFGRVDEDWSL
ETLTDSIKADHGYNMDSRSVKHLLQTMSEFDAQQRREFLQFTTGSPKLPIGGFRSLTPMFTVVCKPSEAPYTSDD
YLPSVMTCVNYLKLPDYTTVGTMKKQLFTAMKEGQGAFHLS
Coding >Ophio5|5492
ATGGCAGAACGAACACCGGCTGGCGAGAACCCAGAGCGACTTGCCTCGTCACCGTCGACAGCCTCTGCTGCCGGC
TTTCAAAGAATAACCAGGTCCTCAGCCCGCCAAGCTGCGAGCCAAGCTGCTCATACATCAGACACTCTCGCTGCG
ACCGTCTCTGCACCGAATTCGACCGTCGCCTCCCAACAACCGGGTCGAAAACGCAAGGTCTCGTCCAACGAAAGC
AGTCCCCAAACAACCTCACGCACTAGCTCTACGGGACGACGATCCAAGAGACAGAAAGTCCCCGAGTCCGCTGCC
CCCACGCCCACGGGCCTGACCGCGTCACTCGCGTCCCGACCGCGAAGAAAGGGAAAGGCTCCCGTCGATATGGAC
AGTCAAGATGGTCTGCCTGGAACTCCAGGTGTCCCCGAAAGCACCGCTGAGGTTTCGAGAAAGTCGAGTCGGAGC
AAGAAGTCGGCGCCTGCAGGAACAGAGTCCAACTCTACATCGGGCCTCGCCTCGCGCAGGCCTCGACGGAACGCA
AATAATGTCGACGACCCGGACACGACGATGAGCGGAACCGAGGAGAATAACGACCCGGGTCCACCTCCACCACCC
CCTCCTCCTGCTGAAGACGATGACAGTGATGATCACGAAGAAGAGGACGAGGGAGGCGAAGAGCGCGGCCGCTAC
GACGGAAATGACGAGGACGACCCGTTTGGCGGATTTGGCGGCCCAGGTTCGGGTTTGTCCAACACTCTTCGGGCT
CTTACCGGCATGATGACGGGACTGTCCGGCCGGCTCCGTGAGCTTCTCAACAACCTGCGACAGGACGACCTCTCG
CTCCAGGTGATTGCCCTGCAGGAACTGTCTGAGATCCTTCTAGTATCCAACGAGGACAATCTGTCGGGGCACTTT
TCTCCCGATGCCTTCGTCAAGGAATTGGTGCTTCTGATGAACAAGGAGGAGAGCCCAGAGGTCATGCTCTTGGCC
TGCCGCTGCCTCGCAAACCTTATGGAGGCGCTGCCGGCGAGCGTGGCCAACGTCGTCTACGGAAATGCAGTGCCT
GTTCTCTGCCAGAAGTTGCTTGAGATATCCTTCATCGATTTGGCGGAGCAGGCACTCAGCACGCTGGAGAAGATA
TCTGCCGAGTATCCGTCGAGCATCGTCCGCGAGGGGGGACTGACGGCTTGTCTCTCCTATCTTGACTTCTTCGCA
ACCAGCACGCAACGGACTGCCGTGACGACGGCCGCCAATTGCTGCCGCAACATACCGGACGACTCCTTCCCCGTC
GTCAAGGAGGTCATGCCCATTCTCCTCAACGTCCTGGGCAGTAGTGACCAGCGGGTTGTCGAGCAAGCCTCGCTG
TGTGTCTCCGGCATCGTCGAGAGCTTCAAGTACCAGTCCGCCAAGCTCGAGGAGCTGGTCAGCGTCGACCTCCTG
CGCGTCGTTCTGAGACTACTCGTCCCAGGCACCACCAACCTTATTGGATCGAATATCCACACCCAGTTTCTTCGT
GTCCTGGCCTTTACAGCCCGTGCCAGCCCGCGTCTCTCGGCAGAACTCTTCAAGCTCAATATTGTTGAGACGCTC
TATCATATCCTGACGGGAGTTTCTCCACCAAGCGGTACTGAGGACGTGGCCTCGAAGCTGGATAGCGTCGTCGTC
ATGCAGGCGCTCATCCACCGCCCGAGGGACCAGATCGTAGAGACGCTCAATGTCATCTGCGAGTTGTTGCCGAGT
CTCCCGCGCAACGCGGATCCTTCCTTCGGGGACTTTGTCGAGCTGGCGTCGTCTACGGAGCCCATTACCCCATCT
TCGGTGGATGGCAGGAGTCGGCGGACCCCCAACGACAAGCGGCTCGAGCTCTTGGAGGATTGCAAGGAGCAAGTC
CGTCGCTTTGCATTGATTATTTTTCCGACTCTCACGGATGCCTTCTCGAGCACGGTCAACCTAAGCGTTCGCCAA
AAGGTGCTGACGGCGCAGCTCAAGATGCTCTCTAACCTGGATGAGGTCATCCTCTCCGAGGCTCTCACCCCGGTT
CCGTATGCGTCCTTCTTGGCGTCGATACTTTCGCAACGGGACCATCCATCGCTGGTGATGCTGGGGCTTCAGGCC
ACGGAGCTTCTCTCGAGCCGCCTAGACAATATTTATCGGTATCAGCTGTACCGTGAAGGGGTCATTTACGAGATC
AACAAGCTAGCAACCGAAGAGGAATCCTCGCAGGATTTGGTCAACCGAAATGACGACGCCGATAAGGCAGCCGGA
ACATCTGGTGGTGGCGGCCGCGGCGGCGATGACGCGTCCGGCTGTGACTCGAACGAGGATGAGGGCAACGAAAAT
GCCGACAACGATGAAGGCGAGGCGCACGACACGTCGGCCGACGACGAGGATGACGAGGACGAGGAAGATGATGAG
GAGAACGGGGACAACGAACACGAGCCGATTCCGGGCGACATGTCTCCTGCCAGTTCTCGGGGATCTACTATGTCC
CTGGACATGCCACCTCACCGATACGTCTCCGATGTTCGGTCCATGAAGTCTCGCATTCGCGACGTGGCCAAGAGA
TTCCTGGAGAACCACGAGAGCGGAGGACACGGTCAGGCCATGAAGGCCGAGGCGGCTGCCATCCTCAACGCCCTG
TCCGACTTGGCGGGTGAGCTGGATGCCTTTTACCTGAAGAGGACGGTCGCCAACCAGGTGCCTCGAAAGGGCAAG
GAGCTTTTCCTCCAGCTGGCCTCCTACTTTGACACGGACGTGTTGGAGAGTGTCACGAGCGCCGAGCTCCTCGCA
TCAGGCCTCGTTCGCACACTGCTCGATGTGTTTAGTAACCCGGATGAGGAGCTCGCTCGTGCGGCGCAGTCGACC
TTCCTCGAAGTCTTCATGGGGCGCGCCCTCAAGTCCAGGCCCAAGACTACGACAGCTGAATCGCCGGCCACTCCG
TTCAGCGTGATGATTCACAAGCTGCAAGATTTGCTCAGTAGGTCTGAGCATTTCGAAGTAATCACGGTTCATCAC
AATACCTTTGACGGGAACCGGAGCAGCCCTGCCTCGATGCTCGGCAAGCAGATTCGCTTGAGAATGGTTGCGGAT
GACGAGTCCAATATCCCTCGGCCGTACAGGAACATCATGGTATCAATACACGCCATCGCCACCTTCAAGTCGTTG
GACGACTACCTTCGGCCTCGCATTAGTTTGGCGGAACGGCCGCAAAACTCTCGTCGAGAAGGACTGGCCAGGGCT
TTCGCGGCCATATCTGGCGCAGGTGGTTTGCCGCTGAGCAGCGCGGCTGCTCGCCTCGTCGACAGGTCAGCGCTA
GCAGGAGGCCCGACGCCTCCGCCGCCGCCGCCTCCGCCGCCACCTCCGGCGGCCTCGACGCCTTCGGGATCGCGT
CACTCGCGGCGGTCGAAGAATCGAAACGCCTCACGCTCGAACGAGCCGTCGGCGCCTGAGCAGCCCGGGGGTTCG
TCGCGCGGGAAAGGCGCTTTGCGACGGTCCTCGCGACGACACGCCGCACCGACTGACGCCGCCCTGCCCCCTCGC
CCTCCGCCCACGGAAGAGGATGAGCCCCGGAGCACGTTGGAATGCGCCGACGAAAGGCAATTGACAGACGACGAC
GAGGCCGAGGACGAGGCCGGCGCCCTAGATGCCATTGTTGGTGAGCTGGACGAGGACATGGACGACGACGACAAG
TCGGCACCCGAGCCGTCTGCCGTCAATCTTGAAGTCGCCACGGGCGGCAAGATCACTGCTCGCAAGGATGACGGA
ACTAGGGTTCCGACACCTGCTGGATCAAGCCTGACCACGCGTAGCGGCGACCATTCGCTTTCCGGCTCCGGGAGG
GGCACGCCGACGCCCTTGACGGCCGCAGCCAGGCCGGTACCGACGCCGGCGGCGCCCATGTCTTATGCCTCGGCC
CTGCAGGCCGTGCCTCAGGATTGGCATATCGAGTTCAGTCTGGACAGCAAGGTGATTCCCAACGAGACGACCATC
TACCGCGCCGTGCACACGTCGACATCGAGCAACTCGGAGGACTTGCTGAGCCGCAGCATCTGGTCTGCCACACAC
CCGATCAAGTTCAGACGAGTTCCTGGTCCGCCACCGGCAGAGTCTCAGGGGTTCGGGTCCAACTCGGACGCCGAG
GTGGACACGGTGAATGGGGTTCCCGCGTCACTAGCCAAGTATCCGACGACGGCTTCCATCCTTCGCCTCCTGAAC
ATCCTCCATGAGCTCAACGCCAACATCGAGGACATCTTGGCAGAGAACAGAAACACCGTTGTCAGCATCAACACA
GAACCGCCGTCTCAGTTTGTCAACACGAAGTTGACGGCCAAGTTGAACCGCCAGCTCGAGGAGCCGCTCATTGTG
GCTAGCAGTTGTCTGCCAAGCTGGTCGGAAGACTTGGCGCGCCTATACCCCTTCCTGTTTCCGTTCGAGACGCGT
CATCTCTTCCTCCAGTCCACGTCGTTCGGATATGCTCGGTCGATGGCTCGGTGGCAGAATGCGCAGTCGGCGGAC
GATAATCGCCGGGACCGCAACAATGACCGCCCGTTTCTCGGGCGGTTGCAGCGGCAGAAGGTGCGCATTTCCAGG
CTCAAGATTCTCGAGTCGGCCCTCAAGGTCATGGACTTGTACGGAGCGTCGCAGAGCATCCTGGAAGTGGAGTAC
TTCGAGGAGGTTGGCACCGGGCTGGGCCCTACGCTGGAGTTCTACTCGACGGTCTCGAGGGAGTTCTCCAAGAAG
AAGCTCAAGCTATGGCGAGAGGTGGACTCGTCGATGTCCGCCGAGTTCGTCTCGGGCCAGGCCGGGCTCTTCCCG
CGGCCGCTCAGCCCGGAGGAGCTCTCTTCCCCCAACGGGGAGCGGATCCTGCACCTTTTCAAGATGTTGGGCAAG
TTTGTGGCTCGGTCTATGATTGACTCGCGCATCATCGACATCCACTTCAACCCCATCTTCTTCCGAATCGGAGAC
ACGCCGTCGACAGGCGTTAAGCCGTCGCTTGGCGCCGTCAAATTGGTGGATCCAGGACTGGCGCGCTCGCTCAAG
GCCATCAAGAACTTCTCGCTGGCCAAGAAGGAGATTGACGAGGATCCCGGTCGATCACCGGCGCAGAAGGTGGCC
GACACGACCAACCTGACGGTCGACAACGTCAGGCTCGAGGATATGTGTCTAGACTTTACACTACCCGGCTACCCT
AACATCGAGCTGGAGGTGAACGGGTCGCACAACCGGGTGACGATGGAGAACGTCGACTTGTATCTCGACAGGGTC
ATCGACATGACGCTCGGGTTTGGCGTGCGCCGGCAGGTCGACGCTTTCCGGACGGGCTTCTCGCAGGTGTTTCCC
TACTCTGCCCTCAGCGCCTTTACGCCCGATGAACTGGTCAGCTTGTTCGGCAGGGTGGATGAGGACTGGTCCCTC
GAGACTTTGACTGATTCCATCAAGGCCGACCACGGCTACAACATGGACAGCCGAAGCGTCAAGCATCTGCTGCAG
ACGATGAGCGAGTTTGACGCGCAGCAACGGCGCGAGTTCTTGCAGTTCACGACGGGCAGTCCCAAGCTCCCGATC
GGCGGCTTCCGGAGCCTGACCCCCATGTTTACGGTGGTGTGCAAGCCGAGCGAAGCGCCCTATACGTCGGACGAC
TACCTACCCAGTGTCATGACGTGTGTCAACTACCTTAAATTGCCCGACTACACGACAGTCGGGACGATGAAGAAG
CAGCTCTTTACAGCCATGAAGGAGGGCCAAGGGGCCTTCCATTTGTCG
Transcript >Ophio5|5492
ATGGCAGAACGAACACCGGCTGGCGAGAACCCAGAGCGACTTGCCTCGTCACCGTCGACAGCCTCTGCTGCCGGC
TTTCAAAGAATAACCAGGTCCTCAGCCCGCCAAGCTGCGAGCCAAGCTGCTCATACATCAGACACTCTCGCTGCG
ACCGTCTCTGCACCGAATTCGACCGTCGCCTCCCAACAACCGGGTCGAAAACGCAAGGTCTCGTCCAACGAAAGC
AGTCCCCAAACAACCTCACGCACTAGCTCTACGGGACGACGATCCAAGAGACAGAAAGTCCCCGAGTCCGCTGCC
CCCACGCCCACGGGCCTGACCGCGTCACTCGCGTCCCGACCGCGAAGAAAGGGAAAGGCTCCCGTCGATATGGAC
AGTCAAGATGGTCTGCCTGGAACTCCAGGTGTCCCCGAAAGCACCGCTGAGGTTTCGAGAAAGTCGAGTCGGAGC
AAGAAGTCGGCGCCTGCAGGAACAGAGTCCAACTCTACATCGGGCCTCGCCTCGCGCAGGCCTCGACGGAACGCA
AATAATGTCGACGACCCGGACACGACGATGAGCGGAACCGAGGAGAATAACGACCCGGGTCCACCTCCACCACCC
CCTCCTCCTGCTGAAGACGATGACAGTGATGATCACGAAGAAGAGGACGAGGGAGGCGAAGAGCGCGGCCGCTAC
GACGGAAATGACGAGGACGACCCGTTTGGCGGATTTGGCGGCCCAGGTTCGGGTTTGTCCAACACTCTTCGGGCT
CTTACCGGCATGATGACGGGACTGTCCGGCCGGCTCCGTGAGCTTCTCAACAACCTGCGACAGGACGACCTCTCG
CTCCAGGTGATTGCCCTGCAGGAACTGTCTGAGATCCTTCTAGTATCCAACGAGGACAATCTGTCGGGGCACTTT
TCTCCCGATGCCTTCGTCAAGGAATTGGTGCTTCTGATGAACAAGGAGGAGAGCCCAGAGGTCATGCTCTTGGCC
TGCCGCTGCCTCGCAAACCTTATGGAGGCGCTGCCGGCGAGCGTGGCCAACGTCGTCTACGGAAATGCAGTGCCT
GTTCTCTGCCAGAAGTTGCTTGAGATATCCTTCATCGATTTGGCGGAGCAGGCACTCAGCACGCTGGAGAAGATA
TCTGCCGAGTATCCGTCGAGCATCGTCCGCGAGGGGGGACTGACGGCTTGTCTCTCCTATCTTGACTTCTTCGCA
ACCAGCACGCAACGGACTGCCGTGACGACGGCCGCCAATTGCTGCCGCAACATACCGGACGACTCCTTCCCCGTC
GTCAAGGAGGTCATGCCCATTCTCCTCAACGTCCTGGGCAGTAGTGACCAGCGGGTTGTCGAGCAAGCCTCGCTG
TGTGTCTCCGGCATCGTCGAGAGCTTCAAGTACCAGTCCGCCAAGCTCGAGGAGCTGGTCAGCGTCGACCTCCTG
CGCGTCGTTCTGAGACTACTCGTCCCAGGCACCACCAACCTTATTGGATCGAATATCCACACCCAGTTTCTTCGT
GTCCTGGCCTTTACAGCCCGTGCCAGCCCGCGTCTCTCGGCAGAACTCTTCAAGCTCAATATTGTTGAGACGCTC
TATCATATCCTGACGGGAGTTTCTCCACCAAGCGGTACTGAGGACGTGGCCTCGAAGCTGGATAGCGTCGTCGTC
ATGCAGGCGCTCATCCACCGCCCGAGGGACCAGATCGTAGAGACGCTCAATGTCATCTGCGAGTTGTTGCCGAGT
CTCCCGCGCAACGCGGATCCTTCCTTCGGGGACTTTGTCGAGCTGGCGTCGTCTACGGAGCCCATTACCCCATCT
TCGGTGGATGGCAGGAGTCGGCGGACCCCCAACGACAAGCGGCTCGAGCTCTTGGAGGATTGCAAGGAGCAAGTC
CGTCGCTTTGCATTGATTATTTTTCCGACTCTCACGGATGCCTTCTCGAGCACGGTCAACCTAAGCGTTCGCCAA
AAGGTGCTGACGGCGCAGCTCAAGATGCTCTCTAACCTGGATGAGGTCATCCTCTCCGAGGCTCTCACCCCGGTT
CCGTATGCGTCCTTCTTGGCGTCGATACTTTCGCAACGGGACCATCCATCGCTGGTGATGCTGGGGCTTCAGGCC
ACGGAGCTTCTCTCGAGCCGCCTAGACAATATTTATCGGTATCAGCTGTACCGTGAAGGGGTCATTTACGAGATC
AACAAGCTAGCAACCGAAGAGGAATCCTCGCAGGATTTGGTCAACCGAAATGACGACGCCGATAAGGCAGCCGGA
ACATCTGGTGGTGGCGGCCGCGGCGGCGATGACGCGTCCGGCTGTGACTCGAACGAGGATGAGGGCAACGAAAAT
GCCGACAACGATGAAGGCGAGGCGCACGACACGTCGGCCGACGACGAGGATGACGAGGACGAGGAAGATGATGAG
GAGAACGGGGACAACGAACACGAGCCGATTCCGGGCGACATGTCTCCTGCCAGTTCTCGGGGATCTACTATGTCC
CTGGACATGCCACCTCACCGATACGTCTCCGATGTTCGGTCCATGAAGTCTCGCATTCGCGACGTGGCCAAGAGA
TTCCTGGAGAACCACGAGAGCGGAGGACACGGTCAGGCCATGAAGGCCGAGGCGGCTGCCATCCTCAACGCCCTG
TCCGACTTGGCGGGTGAGCTGGATGCCTTTTACCTGAAGAGGACGGTCGCCAACCAGGTGCCTCGAAAGGGCAAG
GAGCTTTTCCTCCAGCTGGCCTCCTACTTTGACACGGACGTGTTGGAGAGTGTCACGAGCGCCGAGCTCCTCGCA
TCAGGCCTCGTTCGCACACTGCTCGATGTGTTTAGTAACCCGGATGAGGAGCTCGCTCGTGCGGCGCAGTCGACC
TTCCTCGAAGTCTTCATGGGGCGCGCCCTCAAGTCCAGGCCCAAGACTACGACAGCTGAATCGCCGGCCACTCCG
TTCAGCGTGATGATTCACAAGCTGCAAGATTTGCTCAGTAGGTCTGAGCATTTCGAAGTAATCACGGTTCATCAC
AATACCTTTGACGGGAACCGGAGCAGCCCTGCCTCGATGCTCGGCAAGCAGATTCGCTTGAGAATGGTTGCGGAT
GACGAGTCCAATATCCCTCGGCCGTACAGGAACATCATGGTATCAATACACGCCATCGCCACCTTCAAGTCGTTG
GACGACTACCTTCGGCCTCGCATTAGTTTGGCGGAACGGCCGCAAAACTCTCGTCGAGAAGGACTGGCCAGGGCT
TTCGCGGCCATATCTGGCGCAGGTGGTTTGCCGCTGAGCAGCGCGGCTGCTCGCCTCGTCGACAGGTCAGCGCTA
GCAGGAGGCCCGACGCCTCCGCCGCCGCCGCCTCCGCCGCCACCTCCGGCGGCCTCGACGCCTTCGGGATCGCGT
CACTCGCGGCGGTCGAAGAATCGAAACGCCTCACGCTCGAACGAGCCGTCGGCGCCTGAGCAGCCCGGGGGTTCG
TCGCGCGGGAAAGGCGCTTTGCGACGGTCCTCGCGACGACACGCCGCACCGACTGACGCCGCCCTGCCCCCTCGC
CCTCCGCCCACGGAAGAGGATGAGCCCCGGAGCACGTTGGAATGCGCCGACGAAAGGCAATTGACAGACGACGAC
GAGGCCGAGGACGAGGCCGGCGCCCTAGATGCCATTGTTGGTGAGCTGGACGAGGACATGGACGACGACGACAAG
TCGGCACCCGAGCCGTCTGCCGTCAATCTTGAAGTCGCCACGGGCGGCAAGATCACTGCTCGCAAGGATGACGGA
ACTAGGGTTCCGACACCTGCTGGATCAAGCCTGACCACGCGTAGCGGCGACCATTCGCTTTCCGGCTCCGGGAGG
GGCACGCCGACGCCCTTGACGGCCGCAGCCAGGCCGGTACCGACGCCGGCGGCGCCCATGTCTTATGCCTCGGCC
CTGCAGGCCGTGCCTCAGGATTGGCATATCGAGTTCAGTCTGGACAGCAAGGTGATTCCCAACGAGACGACCATC
TACCGCGCCGTGCACACGTCGACATCGAGCAACTCGGAGGACTTGCTGAGCCGCAGCATCTGGTCTGCCACACAC
CCGATCAAGTTCAGACGAGTTCCTGGTCCGCCACCGGCAGAGTCTCAGGGGTTCGGGTCCAACTCGGACGCCGAG
GTGGACACGGTGAATGGGGTTCCCGCGTCACTAGCCAAGTATCCGACGACGGCTTCCATCCTTCGCCTCCTGAAC
ATCCTCCATGAGCTCAACGCCAACATCGAGGACATCTTGGCAGAGAACAGAAACACCGTTGTCAGCATCAACACA
GAACCGCCGTCTCAGTTTGTCAACACGAAGTTGACGGCCAAGTTGAACCGCCAGCTCGAGGAGCCGCTCATTGTG
GCTAGCAGTTGTCTGCCAAGCTGGTCGGAAGACTTGGCGCGCCTATACCCCTTCCTGTTTCCGTTCGAGACGCGT
CATCTCTTCCTCCAGTCCACGTCGTTCGGATATGCTCGGTCGATGGCTCGGTGGCAGAATGCGCAGTCGGCGGAC
GATAATCGCCGGGACCGCAACAATGACCGCCCGTTTCTCGGGCGGTTGCAGCGGCAGAAGGTGCGCATTTCCAGG
CTCAAGATTCTCGAGTCGGCCCTCAAGGTCATGGACTTGTACGGAGCGTCGCAGAGCATCCTGGAAGTGGAGTAC
TTCGAGGAGGTTGGCACCGGGCTGGGCCCTACGCTGGAGTTCTACTCGACGGTCTCGAGGGAGTTCTCCAAGAAG
AAGCTCAAGCTATGGCGAGAGGTGGACTCGTCGATGTCCGCCGAGTTCGTCTCGGGCCAGGCCGGGCTCTTCCCG
CGGCCGCTCAGCCCGGAGGAGCTCTCTTCCCCCAACGGGGAGCGGATCCTGCACCTTTTCAAGATGTTGGGCAAG
TTTGTGGCTCGGTCTATGATTGACTCGCGCATCATCGACATCCACTTCAACCCCATCTTCTTCCGAATCGGAGAC
ACGCCGTCGACAGGCGTTAAGCCGTCGCTTGGCGCCGTCAAATTGGTGGATCCAGGACTGGCGCGCTCGCTCAAG
GCCATCAAGAACTTCTCGCTGGCCAAGAAGGAGATTGACGAGGATCCCGGTCGATCACCGGCGCAGAAGGTGGCC
GACACGACCAACCTGACGGTCGACAACGTCAGGCTCGAGGATATGTGTCTAGACTTTACACTACCCGGCTACCCT
AACATCGAGCTGGAGGTGAACGGGTCGCACAACCGGGTGACGATGGAGAACGTCGACTTGTATCTCGACAGGGTC
ATCGACATGACGCTCGGGTTTGGCGTGCGCCGGCAGGTCGACGCTTTCCGGACGGGCTTCTCGCAGGTGTTTCCC
TACTCTGCCCTCAGCGCCTTTACGCCCGATGAACTGGTCAGCTTGTTCGGCAGGGTGGATGAGGACTGGTCCCTC
GAGACTTTGACTGATTCCATCAAGGCCGACCACGGCTACAACATGGACAGCCGAAGCGTCAAGCATCTGCTGCAG
ACGATGAGCGAGTTTGACGCGCAGCAACGGCGCGAGTTCTTGCAGTTCACGACGGGCAGTCCCAAGCTCCCGATC
GGCGGCTTCCGGAGCCTGACCCCCATGTTTACGGTGGTGTGCAAGCCGAGCGAAGCGCCCTATACGTCGGACGAC
TACCTACCCAGTGTCATGACGTGTGTCAACTACCTTAAATTGCCCGACTACACGACAGTCGGGACGATGAAGAAG
CAGCTCTTTACAGCCATGAAGGAGGGCCAAGGGGCCTTCCATTTGTCGTGA
Gene >Ophio5|5492
ATGGCAGAACGAACACCGGCTGGCGAGAACCCAGAGCGACTTGCCTCGTCACCGTCGACAGCCTCTGCTGCCGGC
TTTCAAAGGTACGCTGCCATCCTATTTTGCTCTCGTTCTTGTTTTTTCTCAACCTCCGTACTGTACTGCCTGTAT
CCGTCCACAACTCTCTATCTCCCCAGCCTATTCCACCCCGTCTGCCCAGCCCTCTCGCTGCATCATCCTGCCTGC
CCTTGCCCTTTCACGGCTTTACCCCGAGATTGGGCTGCCCGCCTCAGGTGTCCCCCCTCCCGTTCGACGGCCCAG
TGCCGCCCAACAGCTGCCAGCGAGATATTCTTGCGGCCCTACAGCGTGCGCTGGGCCTGGCCTGAGTGGCCCCCC
CCCCCGATTTCCCCAGCCCAGCTCCACCGTGCGCACTGCCTTCAGCACCTGGCATCGGCCAGCTTGTCTTATCTC
CTCCGTCCATCTCCTTCCTCAGCCATCTGCACCCCCTCCATGCTCTTGTTTTTTTTTTCCTCATCCATTTCTTCC
TCGCCACATCCTCCCCGCCTTCTCCACCGCGCCGTCTGGCCTTTCTCTTCGTTGCGTGCCCCGTTGTCGCCTTGC
AATTTTCGTCGCTGCCCCGGTTGAAACACCGTCCGTCGTGCAGGGCACCTTTCCAGACGAACCAACCCTTTCCGT
TTTCCGGCACCAAGCTGCAGCTCCAGCTTGCTTGTGCCGGGTCTCACATTTCTTCCCACCCCATCTTCACGGCCT
TTTTCTCTCCCACACCATTGCATCCATGGTTATTGTAGCACGCTGCCACATTTCGGGTCACTCATGTCTCCCAGA
ATAACCAGGTCCTCAGCCCGCCAAGCTGCGAGCCAAGCTGCTCATACATCAGACACTCTCGCTGCGACCGTCTCT
GCACCGAATTCGACCGTCGCCTCCCAACAACCGGGTCGAAAACGCAAGGTCTCGTCCAACGAAAGCAGTCCCCAA
ACAACCTCACGCACTAGCTCTACGGGACGACGATCCAAGAGACAGAAAGTCCCCGAGTCCGCTGCCCCCACGCCC
ACGGGCCTGACCGCGTCACTCGCGTCCCGACCGCGAAGAAAGGGAAAGGCTCCCGTCGATATGGACAGTCAAGAG
TACGTAACGCTACTTTGTCACAGGCAAAGTCCACGACTGCCCCCTCTTACGTCAAAATCCGCCGAGGGCGCACTT
TCCGCTGAGAGGGAACGCTAACGCTATCGCCACAGTGGTCTGCCTGGAACTCCAGGTGTCCCCGAAAGCACCGCT
GAGGTTTCGAGAAAGTCGAGTCGGAGCAAGAAGTCGGCGCCTGCAGGAACAGGTTTGCAGCCCGTTTCCCCCACC
CTTCATCATTAGCACACTTCTCGGGACCGGCGGCTGACGCTAGTGCAGAGTCCAACTCTACATCGGGCCTCGCCT
CGCGCAGGCCTCGACGGAACGCAAATAATGTCGACGACCCGGACACGACGATGAGCGGAACCGAGGAGAATAACG
ACCCGGGTCCACCTCCACCACCCCCTCCTCCTGCTGAAGACGATGACAGTGATGATCACGAAGAAGAGGACGAGG
GAGGCGAAGAGCGCGGCCGCTACGACGGAAATGACGAGGACGACCCGTTTGGCGGATTTGGCGGCCCAGGTTCGG
GTTTGTCCAACACTCTTCGGGCTCTTACCGGCATGATGACGGGACTGTCCGGCCGGCTCCGTGAGCTTCTCAACA
ACCTGCGACAGGACGACCTCTCGCTCCAGGTGATTGCCCTGCAGGAACTGTCTGAGATCCTTCTAGTATCCAACG
AGGACAATCTGTCGGGGCACTTTTCTCCCGATGCCTTCGTCAAGGAATTGGTGCTTCTGATGAACAAGGAGGAGA
GCCCAGAGGTCATGCTCTTGGCCTGCCGCTGCCTCGCAAACCTTATGGAGGCGCTGCCGGCGAGCGTGGCCAACG
TCGTCTACGGAAATGCAGTGCCTGTTCTCTGCCAGAAGTTGCTTGAGATATCCTTCATCGATTTGGCGGAGCAGG
CACTCAGCACGCTGGAGAAGATATCTGCCGAGTATCCGTCGAGCATCGTCCGCGAGGGGGGACTGACGGCTTGTC
TCTCCTATCTTGACTTCTTCGCAACCAGCACGCAACGGACTGCCGTGACGACGGCCGCCAATTGCTGCCGCAACA
TACCGGACGACTCCTTCCCCGTCGTCAAGGAGGTCATGCCCATTCTCCTCAACGTCCTGGGCAGTAGTGACCAGC
GGGTTGTCGAGCAAGCCTCGCTGTGTGTCTCCGGCATCGTCGAGAGCTTCAAGTACCAGTCCGCCAAGCTCGAGG
AGCTGGTCAGCGTCGACCTCCTGCGCGTCGTTCTGAGACTACTCGTCCCAGGCACCACCAACCTTATTGGATCGA
ATATCCACACCCAGTTTCTTCGTGTCCTGGCCTTTACAGCCCGTGCCAGCCCGCGTCTCTCGGCAGAACTCTTCA
AGCTCAATATTGTTGAGACGCTCTATCATATCCTGACGGGAGTTTCTCCACCAAGCGGTACTGAGGACGTGGCCT
CGAAGCTGGATAGCGTCGTCGTCATGCAGGCGCTCATCCACCGCCCGAGGGACCAGATCGTAGAGACGCTCAATG
TCATCTGCGAGTTGTTGCCGAGTCTCCCGCGCAACGCGGATCCTTCCTTCGGGGACTTTGTCGAGCTGGCGTCGT
CTACGGAGCCCATTACCCCATCTTCGGTGGATGGCAGGAGTCGGCGGACCCCCAACGACAAGCGGCTCGAGCTCT
TGGAGGATTGCAAGGAGCAAGTCCGTCGCTTTGCATTGATTATTTTTCCGACTCTCACGGATGCCTTCTCGAGCA
CGGTCAACCTAAGCGTTCGCCAAAAGGTGCTGACGGCGCAGCTCAAGATGCTCTCTAACCTGGATGAGGTCATCC
TCTCCGAGGCTCTCACCCCGGTTCCGTATGCGTCCTTCTTGGCGTCGATACTTTCGCAACGGGACCATCCATCGC
TGGTGATGCTGGGGCTTCAGGCCACGGAGCTTCTCTCGAGCCGCCTAGACAATATTTATCGGTATCAGCTGTACC
GTGAAGGGGTCATTTACGAGATCAACAAGCTAGCAACCGAAGAGGAATCCTCGCAGGATTTGGTCAACCGAAATG
ACGACGCCGATAAGGCAGCCGGAACATCTGGTGGTGGCGGCCGCGGCGGCGATGACGCGTCCGGCTGTGACTCGA
ACGAGGATGAGGGCAACGAAAATGCCGACAACGATGAAGGCGAGGCGCACGACACGTCGGCCGACGACGAGGATG
ACGAGGACGAGGAAGATGATGAGGAGAACGGGGACAACGAACACGAGCCGATTCCGGGCGACATGTCTCCTGCCA
GTTCTCGGGGATCTACTATGTCCCTGGACATGCCACCTCACCGATACGTCTCCGATGTTCGGTCCATGAAGTCTC
GCATTCGCGACGTGGCCAAGAGATTCCTGGAGAACCACGAGAGCGGAGGACACGGTCAGGCCATGAAGGCCGAGG
CGGCTGCCATCCTCAACGCCCTGTCCGACTTGGCGGGTGAGCTGGATGCCTTTTACCTGAAGAGGACGGTCGCCA
ACCAGGTGCCTCGAAAGGGCAAGGAGCTTTTCCTCCAGCTGGCCTCCTACTTTGACACGGACGTGTTGGAGAGTG
TCACGAGCGCCGAGCTCCTCGCATCAGGCCTCGTTCGCACACTGCTCGATGTGTTTAGTAACCCGGATGAGGAGC
TCGCTCGTGCGGCGCAGTCGACCTTCCTCGAAGTCTTCATGGGGCGCGCCCTCAAGTCCAGGCCCAAGACTACGA
CAGCTGAATCGCCGGCCACTCCGTTCAGCGTGATGATTCACAAGCTGCAAGATTTGCTCAGTAGGTCTGAGCATT
TCGAAGTAATCACGGTTCATCACAATACCTTTGACGGGAACCGGAGCAGCCCTGCCTCGATGCTCGGCAAGCAGA
TTCGCTTGAGAATGGTTGCGGATGACGAGTCCAATATCCCTCGGCCGTACAGGAACATCATGGTATCAATACACG
CCATCGCCACCTTCAAGTCGTTGGACGACTACCTTCGGCCTCGCATTAGTTTGGCGGAACGGCCGCAAAACTCTC
GTCGAGAAGGACTGGCCAGGGCTTTCGCGGCCATATCTGGCGCAGGTGGTTTGCCGCTGAGCAGCGCGGCTGCTC
GCCTCGTCGACAGGTCAGCGCTAGCAGGAGGCCCGACGCCTCCGCCGCCGCCGCCTCCGCCGCCACCTCCGGCGG
CCTCGACGCCTTCGGGATCGCGTCACTCGCGGCGGTCGAAGAATCGAAACGCCTCACGCTCGAACGAGCCGTCGG
CGCCTGAGCAGCCCGGGGGTTCGTCGCGCGGGAAAGGCGCTTTGCGACGGTCCTCGCGACGACACGCCGCACCGA
CTGACGCCGCCCTGCCCCCTCGCCCTCCGCCCACGGAAGAGGATGAGCCCCGGAGCACGTTGGAATGCGCCGACG
AAAGGCAATTGACAGACGACGACGAGGCCGAGGACGAGGCCGGCGCCCTAGATGCCATTGTTGGTGAGCTGGACG
AGGACATGGACGACGACGACAAGTCGGCACCCGAGCCGTCTGCCGTCAATCTTGAAGTCGCCACGGGCGGCAAGA
TCACTGCTCGCAAGGATGACGGAACTAGGGTTCCGACACCTGCTGGATCAAGCCTGACCACGCGTAGCGGCGACC
ATTCGCTTTCCGGCTCCGGGAGGGGCACGCCGACGCCCTTGACGGCCGCAGCCAGGCCGGTACCGACGCCGGCGG
CGCCCATGTCTTATGCCTCGGCCCTGCAGGCCGTGCCTCAGGATTGGCATATCGAGTTCAGTCTGGACAGCAAGG
TGATTCCCAACGAGACGACCATCTACCGCGCCGTGCACACGTCGACATCGAGCAACTCGGAGGACTTGCTGAGCC
GCAGCATCTGGTCTGCCACACACCCGATCAAGTTCAGACGAGTTCCTGGTCCGCCACCGGCAGAGTCTCAGGGGT
TCGGGTCCAACTCGGACGCCGAGGTGGACACGGTGAATGGGGTTCCCGCGTCACTAGCCAAGTATCCGACGACGG
CTTCCATCCTTCGCCTCCTGAACATCCTCCATGAGCTCAACGCCAACATCGAGGACATCTTGGCAGAGAACAGAA
ACACCGTTGTCAGCATCAACACAGAACCGCCGTCTCAGTTTGTCAACACGAAGTTGACGGCCAAGTTGAACCGCC
AGCTCGAGGAGCCGCTCATTGTGGCTAGCAGTTGTCTGCCAAGCTGGTCGGAAGACTTGGCGCGCCTATACCCCT
TCCTGTTTCCGTTCGAGACGCGTCATCTCTTCCTCCAGTCCACGTCGTTCGGATATGCTCGGTCGATGGCTCGGT
GGCAGAATGCGCAGTCGGCGGACGATAATCGCCGGGACCGCAACAATGACCGCCCGTTTCTCGGGCGGTTGCAGC
GGCAGAAGGTGCGCATTTCCAGGCTCAAGATTCTCGAGTCGGCCCTCAAGGTCATGGACTTGTACGGAGCGTCGC
AGAGCATCCTGGAAGTGGAGTACTTCGAGGAGGTTGGCACCGGGCTGGGCCCTACGCTGGAGTTCTACTCGACGG
TCTCGAGGGAGTTCTCCAAGAAGAAGCTCAAGCTATGGCGAGAGGTGGACTCGTCGATGTCCGCCGAGTTCGTCT
CGGGCCAGGCCGGGCTCTTCCCGCGGCCGCTCAGCCCGGAGGAGCTCTCTTCCCCCAACGGGGAGCGGATCCTGC
ACCTTTTCAAGATGTTGGGCAAGTTTGTGGCTCGGTCTATGATTGACTCGCGCATCATCGACATCCACTTCAACC
CCATCTTCTTCCGAATCGGAGACACGCCGTCGACAGGCGTTAAGCCGTCGCTTGGCGCCGTCAAATTGGTGGATC
CAGGACTGGCGCGCTCGCTCAAGGCCATCAAGAACTTCTCGCTGGCCAAGAAGGAGATTGACGAGGATCCCGGTC
GATCACCGGCGCAGAAGGTGGCCGACACGACCAACCTGACGGTCGACAACGTCAGGCTCGAGGATATGTGTCTAG
ACTTTACACTACCCGGCTACCCTAACATCGAGCTGGAGGTGAACGGGTCGCACAACCGGGTGACGATGGAGAACG
TCGACTTGTATCTCGACAGGGTCATCGACATGACGCTCGGGTTTGGCGTGCGCCGGCAGGTCGACGCTTTCCGGA
CGGGCTTCTCGCAGGTGTTTCCCTACTCTGCCCTCAGCGCCTTTACGCCCGATGAACTGGTCAGCTTGTTCGGCA
GGGTGGATGAGGACTGGTCCCTCGAGAGTGAGATGACGATCCCTTTTCGACGAGACGTGGGCTAACAGTGTCAAC
AGCTTTGACTGATTCCATCAAGGCCGACCACGGCTACAACATGGACAGCCGAAGCGTCAAGCATCTGCTGCAGAC
GATGAGCGAGTTTGACGCGCAGCAACGGCGCGAGTTCTTGCAGTTCACGACGGGCAGTCCCAAGCTCCCGATCGG
CGGTAGGTTCCCCCTTGTCCCTGGCAGGCCACTCATGCACTGCTGCTGACGATGTCTGCAGGCTTCCGGAGCCTG
ACCCCCATGTTTACGGTGGTGTGCAAGCCGAGCGAAGCGCCCTATACGTCGGACGACTACCTACCCAGTGTCATG
ACGTGTGTCAACTACCTTAAATTGCCCGACTACACGACAGTCGGGACGATGAAGAAGCAGCTCTTTACAGCCATG
AAGGAGGGCCAAGGGGCCTTCCATTTGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail