Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5486
Gene name
Locationscaffold_45:26906..29834
Strand-
Gene length (bp)2928
Transcript length (bp)2718
Coding sequence length (bp)2715
Protein length (aa) 905

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08632 Zds_C Activator of mitotic machinery Cdc14 phosphatase activation C-term 2.2E-28 736 786

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14100|ZDS1_SCHPO Protein zds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zds1 PE=1 SV=2 167 387 9.0E-18
sp|O14100|ZDS1_SCHPO Protein zds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zds1 PE=1 SV=2 732 832 9.0E-17
sp|P50111|ZDS1_YEAST Protein ZDS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZDS1 PE=1 SV=1 744 785 3.0E-09
sp|P54786|ZDS2_YEAST Protein ZDS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZDS2 PE=1 SV=1 744 785 7.0E-08

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6565 0.2306 0.0436 0.3703 0.0867 0.0179 0.1699 0.377 0.1614 0.016

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2544
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5710
Ophiocordyceps australis map64 (Brazil) OphauB2|869
Ophiocordyceps camponoti-floridani Ophcf2|01373
Ophiocordyceps camponoti-rufipedis Ophun1|2608
Ophiocordyceps kimflemingae Ophio5|5486 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3762

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5486
MMTSSRPRDDIAGNRRGHASQLSISDPSHHVTEAIGTLYGDEDDSGSEGGRPLSFVGGSPHNEQLHRTSPPGLHG
RPPDYQHASESSTPRPPPDQPPDSSSSHAEHGSLRKIQTFVVPSSSSSSQRSNNSYDHSSKSPVSPTPSLRDVQA
DSTGSQFPLTNIDNPSDIAQELSNLQALRRLSMDVGNNIDPDMPPMGFSAMPTVAPSGDDDENDPSRLLWVPARV
HPELAPTEFKSFLEKRVQSIRRRSGDPLLATDFDASLGRSDSLLRRNKSMLSRQIDNTGGRGAVGYVDGAERLER
KRSSSGSQHGPELSLDELVKDPTKAVQRLAKESQSASGGIEGSGDDMPILPMAPGVGLRRSTRTTYRKGGSLRSG
DRGSLSRRLAHRQSEGDYSDISSTLPSEGAKGPIAAAAPSEPGSDSHLRSVRPVRRHRNLSQETTSVMTGADGPA
EETIESRSSSRAQQDWPPARTTSGSGQEASLTPERSERSDSHATRSFPERSSSQNARPPRDHHPETAEEGSARPT
RRPTITNNMKQPAQPQYITKSPNSMHLNTMSDSLASPSSLMGADASRTDNLTFIPTLSQPEKKPEKKSSKRDKDE
DSSGTSSRSGSAWKWFKGVTDERDRKKEEGRKSKARASTERTHDNVRLDVIQTSIDKSGVKGRESLVLDRDNVDS
KLLEERKKEGNRKSDSKKEKDGSIFSSIFGGSKKKEEKEKVQKKSQHLQVPEDVSYKPLAPDVDYNWSRFPLLEE
RAIYRMAHIKLANPRRSLLSQVLLSNFMYSYLAIVQTMHPQMNVPTSPQQKRVEEEARRKRREEEYLARHGEHGT
EHSLDQYNFDYHRAAVQYADSGTDGQAEYVDEAQIYEDEHGDDRDDDEYGYEGVDSPGREMKEYPHGEDDHRRHR
RDDMW
Coding >Ophio5|5486
ATGATGACCTCATCTCGGCCGCGGGACGATATAGCTGGCAACCGGCGCGGCCATGCCAGCCAGCTCTCCATTTCA
GACCCGAGCCACCACGTAACTGAAGCCATCGGTACCCTCTACGGCGACGAGGATGACTCCGGCTCCGAGGGCGGC
CGGCCCTTGAGCTTCGTCGGCGGTTCTCCGCACAACGAACAGTTGCATCGAACATCGCCGCCCGGGCTGCATGGC
CGGCCGCCCGATTATCAGCATGCCAGCGAGAGCTCGACGCCGCGCCCTCCCCCGGATCAGCCGCCGGATTCGTCG
TCCTCCCACGCCGAGCATGGCAGCCTCAGAAAAATACAAACTTTTGTGGTGCCCTCCTCATCCTCTTCCTCGCAG
CGAAGTAACAATTCCTACGATCACAGCTCCAAGTCACCCGTTTCTCCGACGCCATCGCTTCGAGATGTTCAGGCA
GACTCGACAGGATCACAGTTTCCCTTGACCAACATAGACAATCCCAGTGATATTGCTCAGGAGTTAAGCAACTTA
CAAGCCCTCAGAAGACTTTCCATGGACGTCGGAAACAACATAGACCCAGACATGCCTCCCATGGGCTTCTCCGCC
ATGCCCACGGTGGCTCCCAGCGGAGACGATGACGAGAACGATCCATCCAGACTCCTCTGGGTCCCGGCCAGGGTT
CATCCGGAACTGGCTCCAACAGAGTTCAAGTCTTTTCTGGAGAAACGCGTCCAGTCCATCAGGAGAAGGTCAGGA
GACCCTCTCCTCGCCACCGACTTCGACGCGAGCCTCGGCCGTTCCGATTCCCTGCTGAGGAGAAATAAGTCCATG
CTCTCACGGCAGATTGATAACACTGGTGGGCGAGGCGCTGTAGGCTACGTTGACGGTGCCGAGCGTCTCGAGCGA
AAGCGGTCGTCTAGTGGCAGCCAGCACGGTCCGGAGCTCAGTCTCGACGAGCTGGTCAAGGATCCAACCAAAGCA
GTACAAAGACTCGCTAAGGAGTCTCAGAGTGCCTCGGGGGGCATCGAAGGCAGTGGTGACGACATGCCCATTCTT
CCCATGGCACCTGGGGTAGGTTTACGCAGGTCGACGCGCACAACGTACCGCAAGGGTGGGAGCCTGCGATCAGGA
GACCGGGGCTCGTTGTCGAGGCGTCTGGCTCATCGGCAGTCGGAGGGCGACTACTCCGACATCAGCAGCACGCTT
CCGTCAGAAGGGGCCAAGGGACCTATAGCAGCAGCGGCGCCGTCTGAGCCGGGTTCTGACAGTCACCTACGTTCC
GTACGGCCTGTGCGGCGGCACAGAAATCTATCGCAGGAAACGACTTCCGTTATGACTGGCGCGGACGGCCCAGCC
GAGGAGACTATCGAGTCGCGCTCGTCTTCTCGTGCCCAGCAGGACTGGCCGCCGGCCCGAACAACGTCGGGATCC
GGGCAAGAAGCATCTCTGACCCCGGAACGGTCAGAACGATCGGATAGCCATGCGACCAGATCATTTCCCGAGAGG
TCATCTTCCCAGAACGCAAGGCCACCTCGAGACCATCATCCCGAAACTGCAGAGGAGGGCTCTGCTCGCCCAACT
AGACGTCCCACCATTACCAACAACATGAAGCAGCCGGCGCAGCCCCAATATATCACAAAATCGCCAAACTCGATG
CATTTGAACACCATGAGCGATTCTCTGGCATCTCCTTCCTCTCTCATGGGCGCGGATGCCTCTCGCACGGACAAT
CTTACCTTCATTCCGACGCTGAGCCAGCCTGAGAAGAAGCCGGAAAAAAAGTCATCGAAAAGGGATAAAGATGAA
GACTCGTCTGGCACGTCGAGCAGGTCAGGCAGCGCTTGGAAATGGTTCAAGGGTGTCACGGATGAACGGGATCGG
AAGAAAGAGGAGGGAAGGAAGTCGAAGGCGCGAGCCAGCACCGAGAGGACTCATGACAACGTTCGGCTAGACGTG
ATACAAACGTCCATCGATAAAAGCGGCGTGAAGGGACGTGAGAGCCTTGTTTTGGACCGCGACAACGTCGACAGC
AAGCTTCTGGAAGAGAGAAAGAAGGAAGGCAATCGCAAGAGCGACTCAAAGAAAGAGAAGGACGGCAGCATCTTT
TCTTCCATCTTTGGGGGAAGCAAGAAGAAGGAAGAGAAGGAAAAGGTTCAGAAGAAAAGCCAGCACTTGCAGGTG
CCGGAAGACGTTTCCTACAAACCTCTGGCGCCGGACGTGGACTACAACTGGTCAAGGTTTCCGCTCCTAGAAGAG
AGGGCCATCTACCGGATGGCGCACATCAAGCTGGCTAACCCGCGCCGCTCGCTCCTCAGCCAGGTGCTTCTCAGC
AATTTCATGTACAGCTACCTGGCCATCGTGCAGACGATGCATCCACAGATGAATGTGCCGACATCGCCGCAGCAG
AAGCGGGTCGAGGAGGAAGCCAGACGCAAGAGGCGAGAGGAGGAGTACCTGGCCCGGCACGGCGAGCATGGCACC
GAACACAGCCTCGATCAGTACAACTTTGACTATCACAGGGCTGCTGTCCAGTACGCCGATTCTGGGACTGACGGG
CAGGCGGAGTACGTCGACGAAGCCCAAATCTACGAAGACGAGCACGGAGACGACCGCGACGACGATGAGTACGGC
TACGAAGGCGTGGATTCTCCAGGTCGCGAAATGAAGGAGTATCCTCACGGCGAAGACGATCATCGACGGCACCGA
CGAGACGACATGTGG
Transcript >Ophio5|5486
ATGATGACCTCATCTCGGCCGCGGGACGATATAGCTGGCAACCGGCGCGGCCATGCCAGCCAGCTCTCCATTTCA
GACCCGAGCCACCACGTAACTGAAGCCATCGGTACCCTCTACGGCGACGAGGATGACTCCGGCTCCGAGGGCGGC
CGGCCCTTGAGCTTCGTCGGCGGTTCTCCGCACAACGAACAGTTGCATCGAACATCGCCGCCCGGGCTGCATGGC
CGGCCGCCCGATTATCAGCATGCCAGCGAGAGCTCGACGCCGCGCCCTCCCCCGGATCAGCCGCCGGATTCGTCG
TCCTCCCACGCCGAGCATGGCAGCCTCAGAAAAATACAAACTTTTGTGGTGCCCTCCTCATCCTCTTCCTCGCAG
CGAAGTAACAATTCCTACGATCACAGCTCCAAGTCACCCGTTTCTCCGACGCCATCGCTTCGAGATGTTCAGGCA
GACTCGACAGGATCACAGTTTCCCTTGACCAACATAGACAATCCCAGTGATATTGCTCAGGAGTTAAGCAACTTA
CAAGCCCTCAGAAGACTTTCCATGGACGTCGGAAACAACATAGACCCAGACATGCCTCCCATGGGCTTCTCCGCC
ATGCCCACGGTGGCTCCCAGCGGAGACGATGACGAGAACGATCCATCCAGACTCCTCTGGGTCCCGGCCAGGGTT
CATCCGGAACTGGCTCCAACAGAGTTCAAGTCTTTTCTGGAGAAACGCGTCCAGTCCATCAGGAGAAGGTCAGGA
GACCCTCTCCTCGCCACCGACTTCGACGCGAGCCTCGGCCGTTCCGATTCCCTGCTGAGGAGAAATAAGTCCATG
CTCTCACGGCAGATTGATAACACTGGTGGGCGAGGCGCTGTAGGCTACGTTGACGGTGCCGAGCGTCTCGAGCGA
AAGCGGTCGTCTAGTGGCAGCCAGCACGGTCCGGAGCTCAGTCTCGACGAGCTGGTCAAGGATCCAACCAAAGCA
GTACAAAGACTCGCTAAGGAGTCTCAGAGTGCCTCGGGGGGCATCGAAGGCAGTGGTGACGACATGCCCATTCTT
CCCATGGCACCTGGGGTAGGTTTACGCAGGTCGACGCGCACAACGTACCGCAAGGGTGGGAGCCTGCGATCAGGA
GACCGGGGCTCGTTGTCGAGGCGTCTGGCTCATCGGCAGTCGGAGGGCGACTACTCCGACATCAGCAGCACGCTT
CCGTCAGAAGGGGCCAAGGGACCTATAGCAGCAGCGGCGCCGTCTGAGCCGGGTTCTGACAGTCACCTACGTTCC
GTACGGCCTGTGCGGCGGCACAGAAATCTATCGCAGGAAACGACTTCCGTTATGACTGGCGCGGACGGCCCAGCC
GAGGAGACTATCGAGTCGCGCTCGTCTTCTCGTGCCCAGCAGGACTGGCCGCCGGCCCGAACAACGTCGGGATCC
GGGCAAGAAGCATCTCTGACCCCGGAACGGTCAGAACGATCGGATAGCCATGCGACCAGATCATTTCCCGAGAGG
TCATCTTCCCAGAACGCAAGGCCACCTCGAGACCATCATCCCGAAACTGCAGAGGAGGGCTCTGCTCGCCCAACT
AGACGTCCCACCATTACCAACAACATGAAGCAGCCGGCGCAGCCCCAATATATCACAAAATCGCCAAACTCGATG
CATTTGAACACCATGAGCGATTCTCTGGCATCTCCTTCCTCTCTCATGGGCGCGGATGCCTCTCGCACGGACAAT
CTTACCTTCATTCCGACGCTGAGCCAGCCTGAGAAGAAGCCGGAAAAAAAGTCATCGAAAAGGGATAAAGATGAA
GACTCGTCTGGCACGTCGAGCAGGTCAGGCAGCGCTTGGAAATGGTTCAAGGGTGTCACGGATGAACGGGATCGG
AAGAAAGAGGAGGGAAGGAAGTCGAAGGCGCGAGCCAGCACCGAGAGGACTCATGACAACGTTCGGCTAGACGTG
ATACAAACGTCCATCGATAAAAGCGGCGTGAAGGGACGTGAGAGCCTTGTTTTGGACCGCGACAACGTCGACAGC
AAGCTTCTGGAAGAGAGAAAGAAGGAAGGCAATCGCAAGAGCGACTCAAAGAAAGAGAAGGACGGCAGCATCTTT
TCTTCCATCTTTGGGGGAAGCAAGAAGAAGGAAGAGAAGGAAAAGGTTCAGAAGAAAAGCCAGCACTTGCAGGTG
CCGGAAGACGTTTCCTACAAACCTCTGGCGCCGGACGTGGACTACAACTGGTCAAGGTTTCCGCTCCTAGAAGAG
AGGGCCATCTACCGGATGGCGCACATCAAGCTGGCTAACCCGCGCCGCTCGCTCCTCAGCCAGGTGCTTCTCAGC
AATTTCATGTACAGCTACCTGGCCATCGTGCAGACGATGCATCCACAGATGAATGTGCCGACATCGCCGCAGCAG
AAGCGGGTCGAGGAGGAAGCCAGACGCAAGAGGCGAGAGGAGGAGTACCTGGCCCGGCACGGCGAGCATGGCACC
GAACACAGCCTCGATCAGTACAACTTTGACTATCACAGGGCTGCTGTCCAGTACGCCGATTCTGGGACTGACGGG
CAGGCGGAGTACGTCGACGAAGCCCAAATCTACGAAGACGAGCACGGAGACGACCGCGACGACGATGAGTACGGC
TACGAAGGCGTGGATTCTCCAGGTCGCGAAATGAAGGAGTATCCTCACGGCGAAGACGATCATCGACGGCACCGA
CGAGACGACATGTGGTGA
Gene >Ophio5|5486
ATGATGGTGCGTCGTCTCCCACCCCCCGTAGCCAACGGGCCTGGGCTGTCAGGCCCTTCATTTGGTACCCGAGCT
CTATAGATGACGACTAGTTGCGCACCATGACGTCTTCTCGTTGTCTGTGAGTCATTGCTGACTGCTTCTATGGGT
AGACCTCATCTCGGCCGCGGGACGATATAGCTGGCAACCGGCGCGGCCATGCCAGCCAGCTCTCCATTTCAGACC
CGAGCCACCACGTAACTGAAGCCATCGGTACCCTCTACGGCGACGAGGATGACTCCGGCTCCGAGGGCGGCCGGC
CCTTGAGCTTCGTCGGCGGTTCTCCGCACAACGAACAGTTGCATCGAACATCGCCGCCCGGGCTGCATGGCCGGC
CGCCCGATTATCAGCATGCCAGCGAGAGCTCGACGCCGCGCCCTCCCCCGGATCAGCCGCCGGATTCGTCGTCCT
CCCACGCCGAGCATGGCAGCCTCAGAAAAATACAAACTTTTGTGGTGCCCTCCTCATCCTCTTCCTCGCAGCGAA
GTAACAATTCCTACGATCACAGCTCCAAGTCACCCGTTTCTCCGACGCCATCGCTTCGAGATGTTCAGGCAGACT
CGACAGGATCACAGTTTCCCTTGACCAACATAGACAATCCCAGTGATATTGCTCAGGAGTTAAGCAACTTACAAG
CCCTCAGAAGACTTTCCATGGACGTCGGAAACAACATAGACCCAGACATGCCTCCCATGGGCTTCTCCGCCATGC
CCACGGTGGCTCCCAGCGGAGACGATGACGAGAACGATCCATCCAGACTCCTCTGGGTCCCGGCCAGGGTTCATC
CGGAACTGGCTCCAACAGAGTTCAAGTCTTTTCTGGAGAAACGCGTCCAGTCCATCAGGAGAAGGTCAGGAGACC
CTCTCCTCGCCACCGACTTCGACGCGAGCCTCGGCCGTTCCGATTCCCTGCTGAGGAGAAATAAGTCCATGCTCT
CACGGCAGATTGATAACACTGGTGGGCGAGGCGCTGTAGGCTACGTTGACGGTGCCGAGCGTCTCGAGCGAAAGC
GGTCGTCTAGTGGCAGCCAGCACGGTCCGGAGCTCAGTCTCGACGAGCTGGTCAAGGATCCAACCAAAGCAGTAC
AAAGACTCGCTAAGGAGTCTCAGAGTGCCTCGGGGGGCATCGAAGGCAGTGGTGACGACATGCCCATTCTTCCCA
TGGCACCTGGGGTAGGTTTACGCAGGTCGACGCGCACAACGTACCGCAAGGGTGGGAGCCTGCGATCAGGAGACC
GGGGCTCGTTGTCGAGGCGTCTGGCTCATCGGCAGTCGGAGGGCGACTACTCCGACATCAGCAGCACGCTTCCGT
CAGAAGGGGCCAAGGGACCTATAGCAGCAGCGGCGCCGTCTGAGCCGGGTTCTGACAGTCACCTACGTTCCGTAC
GGCCTGTGCGGCGGCACAGAAATCTATCGCAGGAAACGACTTCCGTTATGACTGGCGCGGACGGCCCAGCCGAGG
AGACTATCGAGTCGCGCTCGTCTTCTCGTGCCCAGCAGGACTGGCCGCCGGCCCGAACAACGTCGGGATCCGGGC
AAGAAGCATCTCTGACCCCGGAACGGTCAGAACGATCGGATAGCCATGCGACCAGATCATTTCCCGAGAGGTCAT
CTTCCCAGAACGCAAGGCCACCTCGAGACCATCATCCCGAAACTGCAGAGGAGGGCTCTGCTCGCCCAACTAGAC
GTCCCACCATTACCAACAACATGAAGCAGCCGGCGCAGCCCCAATATATCACAAAATCGCCAAACTCGATGCATT
TGAACACCATGAGCGATTCTCTGGCATCTCCTTCCTCTCTCATGGGCGCGGATGCCTCTCGCACGGACAATCTTA
CCTTCATTCCGACGCTGAGCCAGCCTGAGAAGAAGCCGGAAAAAAAGTCATCGAAAAGGGATAAAGATGAAGACT
CGTCTGGCACGTCGAGCAGGTCAGGCAGCGCTTGGAAATGGTTCAAGGGTGTCACGGATGAACGGGATCGGAAGA
AAGAGGAGGGAAGGAAGTCGAAGGCGCGAGCCAGCACCGAGAGGACTCATGACAACGTTCGGCTAGACGTGATAC
AAACGTCCATCGATAAAAGCGGCGTGAAGGGACGTGAGAGCCTTGTTTTGGACCGCGACAACGTCGACAGCAAGC
TTCTGGAAGAGAGAAAGAAGGAAGGCAATCGCAAGAGCGACTCAAAGAAAGAGAAGGACGGCAGCATCTTTTCTT
CCATCTTTGGGGGAAGCAAGAAGAAGGAAGAGAAGGAAAAGGTTCAGAAGAAAAGCCAGCACTTGCAGGTGCCGG
AAGACGTTTCCTACAAACCTCTGGCGCCGGACGTGGACTACAACTGGTCAAGGTTTCCGCTCCTAGAAGAGAGGG
CCATCTACCGGATGGCGCACATCAAGCTGGCTAACCCGCGCCGCTCGCTCCTCAGCCAGGTGCTTCTCAGCAATT
TCATGTACAGCTACCTGGCCATCGTGCAGACGATGCATCCACAGATGAATGTGCCGACATCGCCGCAGCAGAAGC
GGGTCGAGGAGGAAGCCAGACGCAAGAGGCGAGAGGAGGAGTACCTGGCCCGGCACGGCGAGCATGGCACCGAAC
ACAGCCTCGATCAGTACAACTTTGACTATCACAGGGTGAGTGCTTCTGCATAAATCAAGTACGTCTCGTCTACGC
GGCCGTTGGCTGACCGGCCCCGAGGCTGCTGTCCAGTACGCCGATTCTGGGACTGACGGGCAGGCGGAGTACGTC
GACGAAGCCCAAATCTACGAAGACGAGCACGGAGACGACCGCGACGACGATGAGTACGGCTACGAAGGCGTGGAT
TCTCCAGGTCGCGAAATGAAGGAGTATCCTCACGGCGAAGACGATCATCGACGGCACCGACGAGACGACATGTGG
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail