Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5480
Gene name
Locationscaffold_45:12919..14020
Strand-
Gene length (bp)1101
Transcript length (bp)636
Coding sequence length (bp)633
Protein length (aa) 211

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.4809 0.4293 0.331 0.0733 0.4435 0.3557 0.3842 0.2736 0.2653 0.1092

SignalP

SignalP signal predicted Location Score
Yes 1 - 35 0.95935

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5793
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5705
Ophiocordyceps australis map64 (Brazil) OphauB2|865
Ophiocordyceps camponoti-rufipedis Ophun1|2574
Ophiocordyceps kimflemingae Ophio5|5480 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9815

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5480
MSQALERPAAASLFLFPFLVLFHLPLPPPPQQVWAEPHLRLVSSSRYLWCFRPLQPTSTVSPPLVVGDRRVSRVT
SCIFHFGREYYLPHHHAWHTSRKKPVEQKPAQDAKPAGGEAATATPVTTPAVAPTGTKPAVPAPAVGHTLEADPV
KPVSKPETKPEVKSEAKPEEAAPVSTAADAAPTTSVNPAVGVSDTDKSKGEAAAVAPVPAA
Coding >Ophio5|5480
ATGTCGCAAGCACTCGAGAGGCCTGCTGCAGCCTCTCTCTTCCTTTTCCCTTTCCTCGTCCTCTTCCATCTTCCT
CTTCCGCCCCCTCCTCAGCAAGTCTGGGCAGAGCCTCATCTTCGTCTCGTCTCGTCGTCTCGTTACCTCTGGTGC
TTTCGTCCTTTGCAGCCTACCAGCACCGTCTCCCCGCCTCTCGTCGTGGGAGACCGTCGTGTTTCGCGCGTAACC
TCGTGCATATTTCACTTTGGTAGAGAATACTATCTCCCTCATCACCATGCCTGGCATACCTCCCGCAAGAAGCCT
GTCGAACAGAAGCCCGCCCAAGACGCCAAGCCCGCGGGGGGAGAGGCCGCTACGGCCACCCCCGTCACGACGCCT
GCCGTGGCTCCAACCGGGACCAAGCCTGCAGTGCCCGCCCCGGCTGTCGGACACACTCTCGAGGCAGACCCCGTC
AAGCCCGTGAGCAAGCCTGAGACCAAACCCGAGGTCAAATCCGAGGCCAAGCCTGAAGAGGCTGCTCCAGTGTCC
ACCGCGGCGGACGCGGCACCGACTACGTCTGTGAACCCCGCTGTCGGCGTCTCCGACACGGACAAAAGCAAGGGC
GAGGCCGCCGCCGTCGCTCCTGTGCCGGCCGCT
Transcript >Ophio5|5480
ATGTCGCAAGCACTCGAGAGGCCTGCTGCAGCCTCTCTCTTCCTTTTCCCTTTCCTCGTCCTCTTCCATCTTCCT
CTTCCGCCCCCTCCTCAGCAAGTCTGGGCAGAGCCTCATCTTCGTCTCGTCTCGTCGTCTCGTTACCTCTGGTGC
TTTCGTCCTTTGCAGCCTACCAGCACCGTCTCCCCGCCTCTCGTCGTGGGAGACCGTCGTGTTTCGCGCGTAACC
TCGTGCATATTTCACTTTGGTAGAGAATACTATCTCCCTCATCACCATGCCTGGCATACCTCCCGCAAGAAGCCT
GTCGAACAGAAGCCCGCCCAAGACGCCAAGCCCGCGGGGGGAGAGGCCGCTACGGCCACCCCCGTCACGACGCCT
GCCGTGGCTCCAACCGGGACCAAGCCTGCAGTGCCCGCCCCGGCTGTCGGACACACTCTCGAGGCAGACCCCGTC
AAGCCCGTGAGCAAGCCTGAGACCAAACCCGAGGTCAAATCCGAGGCCAAGCCTGAAGAGGCTGCTCCAGTGTCC
ACCGCGGCGGACGCGGCACCGACTACGTCTGTGAACCCCGCTGTCGGCGTCTCCGACACGGACAAAAGCAAGGGC
GAGGCCGCCGCCGTCGCTCCTGTGCCGGCCGCTTAA
Gene >Ophio5|5480
ATGTCGCAAGCACTCGAGAGGCCTGCTGCAGGTGCCAGGGAGGTACCGGTTGGCAGGTACCCGACCTTCATCTCG
TTCATCGCTCTTTTCTTCTCCTGAGCCTCTCTCTTCCTTTTCCCTTTCCTCGTCCTCTTCCATCTTCCTCTTCCG
CCCCCTCCTCAGCAAGTCTGGGCAGTCTGTCGTCGCCTGCCCATCTTCGTCTACCCTCTGACTGAGTCTCTGCCA
GGAGCCTCATCTTCGTCTCGTCTCGTCGTCTCGTTACCTCTGGTGCTTTCGTCCTTTGCAGCCTACCAGCACCGT
CTCCCCGCCTCTCGTCGTGGGAGACCGTCGTGTTTCGCGCGTAACCTCGTGCATATTTCACTTTGGTAGAGGTTC
GTTGCTGCCCTCACCCATTTGTTTTCCCCGTCCTGACTGACCAGTTTCCGACAGAATACTATCTCCCTCATCACC
ATGCCTGGCATACGTGAGTCATACCCTCTTCACCTTTGCTTCTCTCACCGTCTCTTTGACAAACCCCCCCCCCCC
CTCCCTCTCTCTCTCTTTGCCTCGTGTACCCTCGATTCAAACACCTATGCTAACCGGCCTGCAGCTCCCGGTGCC
TTCGATAACCTCAAGGAAAGGCTCAAGGCCGCCTTCAAGAAGAAGAGCAAGAAGCCTGTCGAACAGAAGCCCGCC
CAAGACGCCAAGCCCGCGGGGGGAGAGGCCGCTACGGCCACCCCCGTCACGACGCCTGCCGTGGCTCCAACCGGG
ACCAAGCCTGCAGTGCCCGCCCCGGCTGGTACGTGCCTCCTCGACGTAATTCGGACCACTTCGACTGACTTGATG
CTCTAGTCGGACACACTCTCGAGGCAGACCCCGTCAAGCCCGTGAGCAAGCCTGAGACCAAACCCGAGGTCAAAT
CCGAGGCCAAGCCTGAAGAGGCTGCTCCAGGTAAAAAACCCCAAACGTGCGACCCTTCGGTCATCGTGAGGCTGA
CGTCTTTTAGTGTCCACCGCGGCGGACGCGGCACCGACTACGTCTGTGAACCCCGCTGTCGGCGTCTCCGACACG
GACAAAAGCAAGGGCGAGGCCGCCGCCGTCGCTCCTGTGCCGGCCGCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail