Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5460
Gene name
Locationscaffold_447:3897..5429
Strand-
Gene length (bp)1532
Transcript length (bp)1467
Coding sequence length (bp)1464
Protein length (aa) 488

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00892 EamA EamA-like transporter family 2.6E-10 135 251
PF00892 EamA EamA-like transporter family 1.7E-08 298 437

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q04835|YM87_YEAST Uncharacterized membrane protein YMR253C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR253C PE=1 SV=1 64 437 1.0E-47
sp|Q08980|YP264_YEAST Probable transport protein YPL264C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL264C PE=1 SV=1 114 437 1.0E-44
sp|Q2M3R5|S35G1_HUMAN Solute carrier family 35 member G1 OS=Homo sapiens GN=SLC35G1 PE=1 SV=1 144 398 3.0E-09
sp|Q8BY79|S35G1_MOUSE Solute carrier family 35 member G1 OS=Mus musculus GN=Slc35g1 PE=2 SV=1 142 268 7.0E-07

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

Domain # Start End Length
1 115 134 19
2 149 168 19
3 181 203 22
4 207 229 22
5 242 259 17
6 295 317 22
7 324 346 22
8 366 388 22
9 395 414 19
10 418 440 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 14.53 6.17 22.89
CcL In ants, during behavior modification 51.88 11.23 92.54
CcD In ants, recently dead 3.34 0.71 5.98

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5460
MASYGGGRGTNVHGRRVKFCVWMHPFRDGLALHVPPLSSAATRPTGGFQPELSHRSPSAATHAKDEAHQRRSSSS
HELRLRSPASPPDVVKQQPLLSEDSSPASPRPRRFWSRNGAAALVALSQLFGALMNLSVRLLELEGSGMHPIQVL
LFRHGLATVFCLSYLWWTKAPDGALGKRQVRWLLLARGITGFVSIFSMWYSMIYLPLADATVITFLAPGIAGLLC
GFILREPFTGTERLATAVALLGVILIAQPVALFSDPGAPQKDSKPSPSSSPSSSQEGFSNAAAAADERLFAVGVA
LLGVMGTAGAFTTLRAISKRTHPMVSINFLGMSCTAICVLVLALAPALDVGQPGLRWVSPTASRQWLLLISLGTL
GFASQYLLTVGLAADTSNRANAMVYTHMLFAVVFDRWVFGHRMQLMSVLGCALILGSAVGVVVFVRKPSPSPVPS
PLPRDDVETGRSSGLFAMVFRWPKLLAVDGAQRREDSA
Coding >Ophio5|5460
ATGGCCTCGTACGGAGGAGGGCGAGGCACGAACGTCCACGGGCGGCGGGTCAAGTTCTGTGTCTGGATGCACCCT
TTCCGTGACGGGCTCGCGCTCCATGTCCCGCCGCTGTCCAGCGCGGCGACGCGGCCGACTGGCGGTTTCCAGCCC
GAACTCTCACACCGCTCGCCATCGGCGGCAACACATGCCAAGGACGAGGCTCACCAGCGCCGGTCGTCGTCGAGC
CATGAGCTGCGGCTGCGGTCCCCGGCATCGCCTCCGGACGTCGTCAAGCAGCAGCCGCTCCTGTCCGAGGATTCG
TCGCCCGCATCTCCCCGGCCGCGCCGCTTCTGGAGCCGGAACGGGGCGGCGGCGCTCGTGGCCCTTTCACAGCTC
TTCGGCGCGCTGATGAACCTCAGCGTGCGGCTGCTCGAACTCGAGGGCAGCGGCATGCACCCTATACAGGTTTTG
CTCTTTCGGCACGGTCTGGCCACTGTCTTCTGTCTGTCGTACCTGTGGTGGACAAAGGCACCAGACGGCGCGCTC
GGCAAGCGACAGGTCCGCTGGCTGCTGCTGGCCAGGGGCATCACCGGGTTCGTCAGCATCTTCAGCATGTGGTAT
TCGATGATCTACCTGCCTCTGGCCGACGCCACCGTCATCACTTTTCTGGCGCCGGGAATTGCCGGCCTACTGTGC
GGTTTCATCCTCCGCGAGCCCTTTACCGGCACGGAGCGGCTTGCCACGGCCGTTGCGCTGCTGGGTGTTATCCTC
ATTGCCCAACCCGTCGCTCTCTTCTCTGATCCAGGCGCACCCCAGAAGGACAGCAAACCATCACCGTCGTCGTCG
CCGTCGTCGTCGCAAGAGGGCTTCTCGAATGCGGCGGCGGCGGCTGACGAGCGCCTATTCGCCGTCGGCGTGGCC
CTGCTGGGCGTCATGGGCACGGCGGGGGCCTTTACGACGCTGCGGGCCATTAGCAAGCGCACCCATCCGATGGTC
TCCATCAACTTCCTCGGAATGAGCTGCACTGCCATCTGCGTCCTCGTCCTGGCGCTGGCCCCGGCACTGGACGTG
GGCCAGCCTGGGCTGCGATGGGTGTCGCCCACGGCGTCAAGACAGTGGCTTCTGCTCATCAGCCTCGGGACCCTG
GGCTTCGCCTCGCAGTACTTGCTTACCGTCGGGCTCGCGGCCGACACGTCGAACCGGGCCAACGCAATGGTCTAC
ACGCACATGCTGTTCGCCGTCGTGTTTGACCGATGGGTCTTTGGACATCGAATGCAGCTGATGAGCGTGCTCGGA
TGCGCGTTGATATTGGGTAGCGCTGTGGGCGTCGTCGTGTTCGTGCGCAAGCCGTCACCATCACCCGTGCCATCT
CCGCTGCCGCGAGATGATGTCGAAACGGGGCGTAGCAGCGGCTTGTTCGCCATGGTGTTCCGATGGCCTAAGCTC
TTGGCTGTTGATGGGGCGCAACGTAGAGAGGATTCTGCT
Transcript >Ophio5|5460
ATGGCCTCGTACGGAGGAGGGCGAGGCACGAACGTCCACGGGCGGCGGGTCAAGTTCTGTGTCTGGATGCACCCT
TTCCGTGACGGGCTCGCGCTCCATGTCCCGCCGCTGTCCAGCGCGGCGACGCGGCCGACTGGCGGTTTCCAGCCC
GAACTCTCACACCGCTCGCCATCGGCGGCAACACATGCCAAGGACGAGGCTCACCAGCGCCGGTCGTCGTCGAGC
CATGAGCTGCGGCTGCGGTCCCCGGCATCGCCTCCGGACGTCGTCAAGCAGCAGCCGCTCCTGTCCGAGGATTCG
TCGCCCGCATCTCCCCGGCCGCGCCGCTTCTGGAGCCGGAACGGGGCGGCGGCGCTCGTGGCCCTTTCACAGCTC
TTCGGCGCGCTGATGAACCTCAGCGTGCGGCTGCTCGAACTCGAGGGCAGCGGCATGCACCCTATACAGGTTTTG
CTCTTTCGGCACGGTCTGGCCACTGTCTTCTGTCTGTCGTACCTGTGGTGGACAAAGGCACCAGACGGCGCGCTC
GGCAAGCGACAGGTCCGCTGGCTGCTGCTGGCCAGGGGCATCACCGGGTTCGTCAGCATCTTCAGCATGTGGTAT
TCGATGATCTACCTGCCTCTGGCCGACGCCACCGTCATCACTTTTCTGGCGCCGGGAATTGCCGGCCTACTGTGC
GGTTTCATCCTCCGCGAGCCCTTTACCGGCACGGAGCGGCTTGCCACGGCCGTTGCGCTGCTGGGTGTTATCCTC
ATTGCCCAACCCGTCGCTCTCTTCTCTGATCCAGGCGCACCCCAGAAGGACAGCAAACCATCACCGTCGTCGTCG
CCGTCGTCGTCGCAAGAGGGCTTCTCGAATGCGGCGGCGGCGGCTGACGAGCGCCTATTCGCCGTCGGCGTGGCC
CTGCTGGGCGTCATGGGCACGGCGGGGGCCTTTACGACGCTGCGGGCCATTAGCAAGCGCACCCATCCGATGGTC
TCCATCAACTTCCTCGGAATGAGCTGCACTGCCATCTGCGTCCTCGTCCTGGCGCTGGCCCCGGCACTGGACGTG
GGCCAGCCTGGGCTGCGATGGGTGTCGCCCACGGCGTCAAGACAGTGGCTTCTGCTCATCAGCCTCGGGACCCTG
GGCTTCGCCTCGCAGTACTTGCTTACCGTCGGGCTCGCGGCCGACACGTCGAACCGGGCCAACGCAATGGTCTAC
ACGCACATGCTGTTCGCCGTCGTGTTTGACCGATGGGTCTTTGGACATCGAATGCAGCTGATGAGCGTGCTCGGA
TGCGCGTTGATATTGGGTAGCGCTGTGGGCGTCGTCGTGTTCGTGCGCAAGCCGTCACCATCACCCGTGCCATCT
CCGCTGCCGCGAGATGATGTCGAAACGGGGCGTAGCAGCGGCTTGTTCGCCATGGTGTTCCGATGGCCTAAGCTC
TTGGCTGTTGATGGGGCGCAACGTAGAGAGGATTCTGCTTGA
Gene >Ophio5|5460
ATGGCCTCGTACGGAGGAGGGCGAGGCACGAACGTCCACGGGCGGCGGGTCAAGTTCTGTGTCTGGATGCACCCT
TTCCGTGACGGGCTCGCGCTGTAAGCAAGCCACCCGTCGCATCTTCCCGCCGAGATCTGCATCTCATGAGGACAC
GACATGCCAGCCATGTCCCGCCGCTGTCCAGCGCGGCGACGCGGCCGACTGGCGGTTTCCAGCCCGAACTCTCAC
ACCGCTCGCCATCGGCGGCAACACATGCCAAGGACGAGGCTCACCAGCGCCGGTCGTCGTCGAGCCATGAGCTGC
GGCTGCGGTCCCCGGCATCGCCTCCGGACGTCGTCAAGCAGCAGCCGCTCCTGTCCGAGGATTCGTCGCCCGCAT
CTCCCCGGCCGCGCCGCTTCTGGAGCCGGAACGGGGCGGCGGCGCTCGTGGCCCTTTCACAGCTCTTCGGCGCGC
TGATGAACCTCAGCGTGCGGCTGCTCGAACTCGAGGGCAGCGGCATGCACCCTATACAGGTTTTGCTCTTTCGGC
ACGGTCTGGCCACTGTCTTCTGTCTGTCGTACCTGTGGTGGACAAAGGCACCAGACGGCGCGCTCGGCAAGCGAC
AGGTCCGCTGGCTGCTGCTGGCCAGGGGCATCACCGGGTTCGTCAGCATCTTCAGCATGTGGTATTCGATGATCT
ACCTGCCTCTGGCCGACGCCACCGTCATCACTTTTCTGGCGCCGGGAATTGCCGGCCTACTGTGCGGTTTCATCC
TCCGCGAGCCCTTTACCGGCACGGAGCGGCTTGCCACGGCCGTTGCGCTGCTGGGTGTTATCCTCATTGCCCAAC
CCGTCGCTCTCTTCTCTGATCCAGGCGCACCCCAGAAGGACAGCAAACCATCACCGTCGTCGTCGCCGTCGTCGT
CGCAAGAGGGCTTCTCGAATGCGGCGGCGGCGGCTGACGAGCGCCTATTCGCCGTCGGCGTGGCCCTGCTGGGCG
TCATGGGCACGGCGGGGGCCTTTACGACGCTGCGGGCCATTAGCAAGCGCACCCATCCGATGGTCTCCATCAACT
TCCTCGGAATGAGCTGCACTGCCATCTGCGTCCTCGTCCTGGCGCTGGCCCCGGCACTGGACGTGGGCCAGCCTG
GGCTGCGATGGGTGTCGCCCACGGCGTCAAGACAGTGGCTTCTGCTCATCAGCCTCGGGACCCTGGGCTTCGCCT
CGCAGTACTTGCTTACCGTCGGGCTCGCGGCCGACACGTCGAACCGGGCCAACGCAATGGTCTACACGCACATGC
TGTTCGCCGTCGTGTTTGACCGATGGGTCTTTGGACATCGAATGCAGCTGATGAGCGTGCTCGGATGCGCGTTGA
TATTGGGTAGCGCTGTGGGCGTCGTCGTGTTCGTGCGCAAGCCGTCACCATCACCCGTGCCATCTCCGCTGCCGC
GAGATGATGTCGAAACGGGGCGTAGCAGCGGCTTGTTCGCCATGGTGTTCCGATGGCCTAAGCTCTTGGCTGTTG
ATGGGGCGCAACGTAGAGAGGATTCTGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail