Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5456
Gene name
Locationscaffold_446:12584..13532
Strand+
Gene length (bp)948
Transcript length (bp)948
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.3E-17 1 268

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 1 312 2.0E-60
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 1 312 1.0E-41
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 1 312 4.0E-41
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 1 311 2.0E-34
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 2 315 8.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 1 312 2.0E-60
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 1 312 1.0E-41
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 1 312 4.0E-41
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 1 311 2.0E-34
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 2 315 8.0E-34
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 2 314 7.0E-33
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 2 314 3.0E-32
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 1 314 8.0E-31
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 1 314 2.0E-30
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 2 314 3.0E-29
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 1 311 3.0E-28
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 2 314 6.0E-27
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 24 314 2.0E-24
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 24 314 2.0E-23
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 24 314 2.0E-23
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 24 314 1.0E-22
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 24 314 5.0E-21
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 168 312 2.0E-20
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 1 315 7.0E-20
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 1 310 1.0E-19
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 13 310 3.0E-18
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 1 310 2.0E-17
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 1 310 2.0E-17
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 1 314 3.0E-16
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 24 311 5.0E-16
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 1 314 4.0E-15
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 1 314 2.0E-09
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 1 295 1.0E-08
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 150 293 3.0E-08
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 1 314 4.0E-08
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 128 310 2.0E-06
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 3 313 3.0E-06
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 87 263 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 41 63 22
3 113 135 22
4 145 167 22
5 188 210 22
6 220 242 22
7 254 276 22
8 286 305 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.51 0.0 1.30
CcL In ants, during behavior modification 0.24 0.0 0.78
CcD In ants, recently dead 0.06 0.0 0.39

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 1.0 no
SC16a CcD 1.0 no
CcL CcD 1.0 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5456
MADMYRKEDRGKSLAIATFVPYLGPALGPVVGGIMTQKLQWWWLFYLLSIFDAAICLVGLLVVRESYGPVLLARK
RSLAGPTAIRAASARTSIGAVLCRPLLLLWQRPVIQVIALILALNFGVYCLLLSTFATLWIRRYGQSELISTLHY
IAVSIGTTIATQAGGHFMDWVFARLKARSPDGSTSPEFRVPCLVPPVILIPVGLFWYGWAAEVGAHWAVVDVGVA
VFVCGSFLLAQAMLAYLLDEFSHAASANAAGRLLSNLLGFVFPIFAPQLFAHLGYGWGNSLLAFVFIGLGCPMPL
LLWIWGARLRALGRT
Coding >Ophio5|5456
ATGGCCGACATGTACCGCAAGGAGGACCGGGGCAAATCGCTCGCCATTGCCACCTTCGTCCCGTACTTGGGCCCC
GCCTTAGGTCCGGTTGTGGGCGGCATCATGACGCAGAAGCTGCAGTGGTGGTGGCTGTTCTATCTCCTGAGCATC
TTCGACGCCGCCATCTGCCTCGTTGGCCTCTTGGTCGTCAGGGAGAGCTACGGACCCGTGCTGCTGGCTCGCAAA
CGCAGTCTAGCGGGACCGACGGCGATTCGAGCCGCGTCTGCTAGGACCAGTATAGGGGCCGTCCTGTGCCGGCCG
CTGCTGCTGCTCTGGCAACGGCCCGTCATCCAAGTCATAGCCTTGATCTTGGCCCTCAACTTTGGCGTCTACTGC
CTGTTGCTTTCCACCTTTGCTACGCTATGGATCAGGCGCTACGGCCAGTCCGAGTTGATCAGCACCCTCCACTAC
ATCGCCGTATCGATCGGAACCACCATCGCCACGCAAGCCGGTGGACACTTCATGGATTGGGTGTTTGCGAGGCTC
AAGGCGCGTTCGCCCGACGGCAGTACCAGTCCCGAGTTCCGGGTGCCATGCCTGGTTCCGCCCGTCATTCTCATC
CCCGTCGGCCTCTTCTGGTACGGCTGGGCGGCCGAGGTGGGCGCTCACTGGGCCGTCGTCGACGTCGGCGTGGCC
GTCTTCGTCTGCGGCAGCTTCCTGTTGGCGCAAGCCATGCTGGCCTACTTGCTGGATGAGTTCTCTCACGCGGCG
TCGGCTAACGCGGCCGGTCGGCTGCTATCCAACCTGCTAGGCTTCGTCTTTCCCATCTTCGCGCCGCAACTGTTT
GCCCATCTGGGGTACGGATGGGGCAACAGCTTGCTCGCCTTTGTATTCATCGGTCTCGGCTGTCCGATGCCGCTG
CTGCTATGGATATGGGGAGCCAGACTGAGGGCGCTGGGTCGTACG
Transcript >Ophio5|5456
ATGGCCGACATGTACCGCAAGGAGGACCGGGGCAAATCGCTCGCCATTGCCACCTTCGTCCCGTACTTGGGCCCC
GCCTTAGGTCCGGTTGTGGGCGGCATCATGACGCAGAAGCTGCAGTGGTGGTGGCTGTTCTATCTCCTGAGCATC
TTCGACGCCGCCATCTGCCTCGTTGGCCTCTTGGTCGTCAGGGAGAGCTACGGACCCGTGCTGCTGGCTCGCAAA
CGCAGTCTAGCGGGACCGACGGCGATTCGAGCCGCGTCTGCTAGGACCAGTATAGGGGCCGTCCTGTGCCGGCCG
CTGCTGCTGCTCTGGCAACGGCCCGTCATCCAAGTCATAGCCTTGATCTTGGCCCTCAACTTTGGCGTCTACTGC
CTGTTGCTTTCCACCTTTGCTACGCTATGGATCAGGCGCTACGGCCAGTCCGAGTTGATCAGCACCCTCCACTAC
ATCGCCGTATCGATCGGAACCACCATCGCCACGCAAGCCGGTGGACACTTCATGGATTGGGTGTTTGCGAGGCTC
AAGGCGCGTTCGCCCGACGGCAGTACCAGTCCCGAGTTCCGGGTGCCATGCCTGGTTCCGCCCGTCATTCTCATC
CCCGTCGGCCTCTTCTGGTACGGCTGGGCGGCCGAGGTGGGCGCTCACTGGGCCGTCGTCGACGTCGGCGTGGCC
GTCTTCGTCTGCGGCAGCTTCCTGTTGGCGCAAGCCATGCTGGCCTACTTGCTGGATGAGTTCTCTCACGCGGCG
TCGGCTAACGCGGCCGGTCGGCTGCTATCCAACCTGCTAGGCTTCGTCTTTCCCATCTTCGCGCCGCAACTGTTT
GCCCATCTGGGGTACGGATGGGGCAACAGCTTGCTCGCCTTTGTATTCATCGGTCTCGGCTGTCCGATGCCGCTG
CTGCTATGGATATGGGGAGCCAGACTGAGGGCGCTGGGTCGTACGTGA
Gene >Ophio5|5456
ATGGCCGACATGTACCGCAAGGAGGACCGGGGCAAATCGCTCGCCATTGCCACCTTCGTCCCGTACTTGGGCCCC
GCCTTAGGTCCGGTTGTGGGCGGCATCATGACGCAGAAGCTGCAGTGGTGGTGGCTGTTCTATCTCCTGAGCATC
TTCGACGCCGCCATCTGCCTCGTTGGCCTCTTGGTCGTCAGGGAGAGCTACGGACCCGTGCTGCTGGCTCGCAAA
CGCAGTCTAGCGGGACCGACGGCGATTCGAGCCGCGTCTGCTAGGACCAGTATAGGGGCCGTCCTGTGCCGGCCG
CTGCTGCTGCTCTGGCAACGGCCCGTCATCCAAGTCATAGCCTTGATCTTGGCCCTCAACTTTGGCGTCTACTGC
CTGTTGCTTTCCACCTTTGCTACGCTATGGATCAGGCGCTACGGCCAGTCCGAGTTGATCAGCACCCTCCACTAC
ATCGCCGTATCGATCGGAACCACCATCGCCACGCAAGCCGGTGGACACTTCATGGATTGGGTGTTTGCGAGGCTC
AAGGCGCGTTCGCCCGACGGCAGTACCAGTCCCGAGTTCCGGGTGCCATGCCTGGTTCCGCCCGTCATTCTCATC
CCCGTCGGCCTCTTCTGGTACGGCTGGGCGGCCGAGGTGGGCGCTCACTGGGCCGTCGTCGACGTCGGCGTGGCC
GTCTTCGTCTGCGGCAGCTTCCTGTTGGCGCAAGCCATGCTGGCCTACTTGCTGGATGAGTTCTCTCACGCGGCG
TCGGCTAACGCGGCCGGTCGGCTGCTATCCAACCTGCTAGGCTTCGTCTTTCCCATCTTCGCGCCGCAACTGTTT
GCCCATCTGGGGTACGGATGGGGCAACAGCTTGCTCGCCTTTGTATTCATCGGTCTCGGCTGTCCGATGCCGCTG
CTGCTATGGATATGGGGAGCCAGACTGAGGGCGCTGGGTCGTACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail