Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5455
Gene name
Locationscaffold_446:9718..10202
Strand-
Gene length (bp)484
Transcript length (bp)408
Coding sequence length (bp)405
Protein length (aa) 135

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11807 UstYa Mycotoxin biosynthesis protein UstYa 8.3E-38 12 112

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0043386 mycotoxin biosynthetic process Yes
GO:0044550 secondary metabolite biosynthetic process No
GO:0009987 cellular process No
GO:0044249 cellular biosynthetic process No
GO:0019748 secondary metabolic process No
GO:0009404 toxin metabolic process No
GO:0009403 toxin biosynthetic process No
GO:0009058 biosynthetic process No
GO:0043385 mycotoxin metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2766 0.1626 0.703 0.3375 0.2302 0.0023 0.0297 0.2262 0.075 0.0218

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup114
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3017
Ophiocordyceps australis 1348a (Ghana) OphauG2|4487
Ophiocordyceps australis map64 (Brazil) OphauB2|5245
Ophiocordyceps australis map64 (Brazil) OphauB2|5793
Ophiocordyceps australis map64 (Brazil) OphauB2|5794
Ophiocordyceps camponoti-rufipedis Ophun1|4502
Ophiocordyceps kimflemingae Ophio5|2991
Ophiocordyceps kimflemingae Ophio5|5411
Ophiocordyceps kimflemingae Ophio5|5454
Ophiocordyceps kimflemingae Ophio5|5455 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2146
Ophiocordyceps subramaniannii Hirsu2|3267
Ophiocordyceps subramaniannii Hirsu2|9574

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5455
MRHFGRLNIGVAAPDGSGFLGTLNVFHEIHCLKRIKQYMYPDYYFPNMTDDAREMNRLHNEHCIDFLRQSAMCHG
DIGLLTYEWHDDYSIPVANATTHHCVNWDKLNDWARARSVDMLKPGWLVHPTKGVVYPIA
Coding >Ophio5|5455
ATGCGTCACTTTGGCAGGCTAAACATTGGCGTCGCCGCCCCGGACGGCAGCGGTTTCCTCGGCACCCTCAACGTC
TTTCACGAGATTCACTGCCTCAAGCGTATCAAGCAATACATGTACCCGGACTATTACTTCCCCAACATGACTGAC
GACGCCCGTGAGATGAATCGTCTCCATAATGAGCACTGCATCGACTTTCTCCGTCAGTCGGCCATGTGCCACGGC
GATATCGGCCTCCTCACCTACGAGTGGCACGACGACTACTCCATTCCTGTTGCTAATGCTACCACACACCACTGC
GTCAACTGGGATAAGCTCAATGATTGGGCGCGGGCGCGGTCTGTCGACATGTTGAAGCCCGGATGGTTGGTGCAT
CCCACCAAAGGCGTCGTGTATCCTATTGCA
Transcript >Ophio5|5455
ATGCGTCACTTTGGCAGGCTAAACATTGGCGTCGCCGCCCCGGACGGCAGCGGTTTCCTCGGCACCCTCAACGTC
TTTCACGAGATTCACTGCCTCAAGCGTATCAAGCAATACATGTACCCGGACTATTACTTCCCCAACATGACTGAC
GACGCCCGTGAGATGAATCGTCTCCATAATGAGCACTGCATCGACTTTCTCCGTCAGTCGGCCATGTGCCACGGC
GATATCGGCCTCCTCACCTACGAGTGGCACGACGACTACTCCATTCCTGTTGCTAATGCTACCACACACCACTGC
GTCAACTGGGATAAGCTCAATGATTGGGCGCGGGCGCGGTCTGTCGACATGTTGAAGCCCGGATGGTTGGTGCAT
CCCACCAAAGGCGTCGTGTATCCTATTGCATAA
Gene >Ophio5|5455
ATGCGTCACTTTGGCAGGCTAAACATTGGCGTCGCCGCCCCGGACGGCAGCGGTTTCCTCGGCACCCTCAACGTC
TTTCACGAGATTCACTGCCTCAAGCGTATCAAGCAATACATGTACCCGGACTATTACTTCCCCAACATGACTGAC
GACGCCCGTGAGATGAATCGTCTCCATAATGAGCACTGCATCGACTTTCTCCGTCAGTCGGCCATGTGCCACGGC
GATATCGGCCTCCTCACCTACGAGTGGCACGACGACTACTCCATTCCTGTTGCTAATGCTACCACACACCACTGC
GTCAACTGGGATAAGCTCAATGATTGGGCGCGGGCGCGGTCTGTCGACATGTTGAAGCCCGGATGGTTGGTGCAT
CCCACCAAAGGTGAGGGAATGAAACACCATGCCAAGCATGATAACTGTCATGGACTCGTTACTGACGTAGAGATT
GCTATATACAGGCGTCGTGTATCCTATTGCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail