Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5454
Gene name
Locationscaffold_446:8129..9252
Strand+
Gene length (bp)1123
Transcript length (bp)915
Coding sequence length (bp)912
Protein length (aa) 304

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11807 UstYa Mycotoxin biosynthesis protein UstYa 1.5E-41 46 264

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0043386 mycotoxin biosynthetic process Yes
GO:0044550 secondary metabolite biosynthetic process No
GO:0009987 cellular process No
GO:0044249 cellular biosynthetic process No
GO:0019748 secondary metabolic process No
GO:0009404 toxin metabolic process No
GO:0009403 toxin biosynthetic process No
GO:0009058 biosynthetic process No
GO:0043385 mycotoxin metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.5

Transmembrane Domains

Domain # Start End Length
1 57 79 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5454
MMPVSPVIFSMDEDCEKSVDKPFIPKDGKFKPGSDQESSNGPRPHQNTWFRRNRRHLLIHGIFFIFYSIWTTALL
RQAGRNCWDQRNLFTPVQDYIRHRVDVFSDRPHDVSSSKFVGTSSPELDKEWYRLLRHELRAMNQTSIPLQRGGG
YMGMMAVFHELHCLVRSRRTDYWQSSSKLTGKQKLVREAVHKDYYYQNESEASKAILVGHTEHCIDILRMGSMCR
ADTAIFPYHWTDGTRLPSPTWFQKHECVDWDDLTGWLEKRRIDIYEPNLLVHPKYGPAYPGGKRIEEPNGPQVLP
LDEV
Coding >Ophio5|5454
ATGATGCCTGTTTCGCCGGTGATATTCTCCATGGACGAAGATTGCGAGAAGTCGGTTGATAAGCCATTCATCCCA
AAGGATGGCAAGTTCAAGCCTGGCTCGGACCAAGAGTCTTCCAACGGGCCGAGACCGCATCAGAATACCTGGTTT
CGACGTAACCGTCGCCATCTCTTGATTCATGGCATATTTTTCATCTTCTATAGCATCTGGACTACCGCTCTGCTA
CGGCAGGCTGGCCGCAACTGCTGGGATCAACGCAACCTATTCACACCAGTTCAGGACTATATTCGCCACAGGGTG
GACGTCTTTTCTGATCGTCCACACGACGTCTCCTCTAGTAAGTTCGTAGGGACTTCGTCTCCCGAGCTGGACAAG
GAATGGTACCGACTCCTTCGACACGAACTTCGAGCGATGAATCAAACATCAATACCACTGCAGCGTGGCGGTGGA
TATATGGGCATGATGGCCGTTTTCCATGAGCTACATTGCTTGGTGAGATCAAGGCGTACTGACTACTGGCAGAGT
AGTTCGAAGCTCACAGGCAAGCAGAAACTAGTTCGTGAAGCGGTCCATAAGGATTACTACTACCAAAACGAGAGC
GAAGCATCCAAAGCCATACTCGTAGGACACACGGAGCACTGCATCGATATCCTGCGGATGGGAAGCATGTGCCGC
GCCGATACAGCCATCTTCCCCTATCATTGGACCGACGGCACACGTCTGCCTAGTCCAACTTGGTTTCAGAAGCAC
GAATGCGTCGACTGGGACGACTTGACTGGCTGGCTTGAGAAGAGGAGAATCGACATTTACGAACCCAATCTACTA
GTTCACCCGAAATACGGACCTGCTTATCCTGGTGGGAAAAGAATCGAAGAGCCCAACGGGCCCCAAGTACTTCCC
CTCGACGAGGTC
Transcript >Ophio5|5454
ATGATGCCTGTTTCGCCGGTGATATTCTCCATGGACGAAGATTGCGAGAAGTCGGTTGATAAGCCATTCATCCCA
AAGGATGGCAAGTTCAAGCCTGGCTCGGACCAAGAGTCTTCCAACGGGCCGAGACCGCATCAGAATACCTGGTTT
CGACGTAACCGTCGCCATCTCTTGATTCATGGCATATTTTTCATCTTCTATAGCATCTGGACTACCGCTCTGCTA
CGGCAGGCTGGCCGCAACTGCTGGGATCAACGCAACCTATTCACACCAGTTCAGGACTATATTCGCCACAGGGTG
GACGTCTTTTCTGATCGTCCACACGACGTCTCCTCTAGTAAGTTCGTAGGGACTTCGTCTCCCGAGCTGGACAAG
GAATGGTACCGACTCCTTCGACACGAACTTCGAGCGATGAATCAAACATCAATACCACTGCAGCGTGGCGGTGGA
TATATGGGCATGATGGCCGTTTTCCATGAGCTACATTGCTTGGTGAGATCAAGGCGTACTGACTACTGGCAGAGT
AGTTCGAAGCTCACAGGCAAGCAGAAACTAGTTCGTGAAGCGGTCCATAAGGATTACTACTACCAAAACGAGAGC
GAAGCATCCAAAGCCATACTCGTAGGACACACGGAGCACTGCATCGATATCCTGCGGATGGGAAGCATGTGCCGC
GCCGATACAGCCATCTTCCCCTATCATTGGACCGACGGCACACGTCTGCCTAGTCCAACTTGGTTTCAGAAGCAC
GAATGCGTCGACTGGGACGACTTGACTGGCTGGCTTGAGAAGAGGAGAATCGACATTTACGAACCCAATCTACTA
GTTCACCCGAAATACGGACCTGCTTATCCTGGTGGGAAAAGAATCGAAGAGCCCAACGGGCCCCAAGTACTTCCC
CTCGACGAGGTCTAG
Gene >Ophio5|5454
ATGATGCCTGTTTCGCCGGTGATATTCTCCATGGACGAAGATTGCGAGAAGTCGGTTGATAAGCCATTCATCCCA
AAGGATGGCAAGTTCAAGCCTGGCTCGGACCAAGAGTCTTCCAACGGGCCGAGACCGCATCAGAATACCTGGTTT
CGACGTAACCGTCGCCATCTCTTGATTCATGGCATATTTTTCATCTTCTATAGCATCTGGACTACCGCTCTGCTA
CGGCAGGCTGGCCGCAACTGCTGGGATCAACGCAACCTATTCAGTAAGTCATAGCTCAGAGCATCAAGTACGGGA
TGCTTACGTGCCTGATAGCACCAGTTCAGGACTATATTCGCCACAGGGTGGACGTCTTTTCTGATCGTCCACACG
ACGTCTCCTCTAGTAAGTTCGTAGGGACTTCGTCTCCCGAGCTGGACAAGGAATGGTACCGACTCCTTCGACGTA
AGTCCTCAAAGCCTGAAAAAGTTCCTCTACCGCTCCCGTCGAACAGTATTCAACAATAATTCAGATCATAATATA
CGTGTTTTCGAAGACGAACTTCGAGCGATGAATCAAACATCAATACCACTGCAGCGTGGCGGTGGATATATGGGC
ATGATGGCCGTTTTCCATGAGCTACATTGCTTGGTGAGATCAAGGCGTACTGACTACTGGCAGAGTAGTTCGAAG
CTCACAGGCAAGCAGAAACTAGTTCGTGAAGCGGTCCATAAGGATTACTACTACCAAAACGAGAGCGAAGCATCC
AAAGCCATACTCGTAGGACACACGGAGCACTGCATCGATATCCTGCGGATGGGAAGCATGTGCCGCGCCGATACA
GCCATCTTCCCCTATCATTGGACCGACGGCACACGTCTGCCTAGTCCAACTTGGTTTCAGAAGCACGAATGCGTC
GACTGGGACGACTTGACTGGCTGGCTTGAGAAGAGGAGAATCGACATTTACGAACCCAATCTACTAGTTCACCCG
AAATACGGTAATCAAGTCCGCAAACTACAACACGCAGTATGGACAAGATGCTAATGCTGGGCTTCTCGTAACAGG
ACCTGCTTATCCTGGTGGGAAAAGAATCGAAGAGCCCAACGGGCCCCAAGTACTTCCCCTCGACGAGGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail