Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5451
Gene name
Locationscaffold_446:2948..3762
Strand-
Gene length (bp)814
Transcript length (bp)636
Coding sequence length (bp)633
Protein length (aa) 211

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01105 EMP24_GP25L emp24/gp25L/p24 family/GOLD 7.6E-47 22 204

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13770|YE98_SCHPO Uncharacterized membrane protein C17A5.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A5.08 PE=3 SV=1 1 209 4.0E-53
sp|Q12403|ERP3_YEAST Protein ERP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP3 PE=1 SV=1 20 211 2.0E-30
sp|Q769F9|TMEDA_DICDI Transmembrane emp24 domain-containing protein A OS=Dictyostelium discoideum GN=empA PE=3 SV=1 13 207 2.0E-24
sp|O17528|TMED2_CAEEL Suppressor/enhancer of lin-12 protein 9 OS=Caenorhabditis elegans GN=sel-9 PE=1 SV=1 14 204 3.0E-24
sp|Q12450|ERP4_YEAST Protein ERP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP4 PE=1 SV=1 1 211 4.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13770|YE98_SCHPO Uncharacterized membrane protein C17A5.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A5.08 PE=3 SV=1 1 209 4.0E-53
sp|Q12403|ERP3_YEAST Protein ERP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP3 PE=1 SV=1 20 211 2.0E-30
sp|Q769F9|TMEDA_DICDI Transmembrane emp24 domain-containing protein A OS=Dictyostelium discoideum GN=empA PE=3 SV=1 13 207 2.0E-24
sp|O17528|TMED2_CAEEL Suppressor/enhancer of lin-12 protein 9 OS=Caenorhabditis elegans GN=sel-9 PE=1 SV=1 14 204 3.0E-24
sp|Q12450|ERP4_YEAST Protein ERP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP4 PE=1 SV=1 1 211 4.0E-24
sp|P39704|ERP2_YEAST Protein ERP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP2 PE=1 SV=1 1 211 4.0E-23
sp|P49020|TMED2_CRIGR Transmembrane emp24 domain-containing protein 2 (Fragment) OS=Cricetulus griseus GN=TMED2 PE=1 SV=1 27 207 2.0E-22
sp|Q9R0Q3|TMED2_MOUSE Transmembrane emp24 domain-containing protein 2 OS=Mus musculus GN=Tmed2 PE=1 SV=1 27 207 2.0E-22
sp|Q63524|TMED2_RAT Transmembrane emp24 domain-containing protein 2 OS=Rattus norvegicus GN=Tmed2 PE=1 SV=1 27 207 2.0E-22
sp|Q15363|TMED2_HUMAN Transmembrane emp24 domain-containing protein 2 OS=Homo sapiens GN=TMED2 PE=1 SV=1 27 207 2.0E-22
sp|A7SXK3|TMED_NEMVE Transmembrane emp24 domain-containing protein OS=Nematostella vectensis GN=v1g194562 PE=3 SV=1 12 207 4.0E-22
sp|Q54BN0|TMEDB_DICDI Transmembrane emp24 domain-containing protein B OS=Dictyostelium discoideum GN=empB PE=3 SV=1 20 211 3.0E-21
sp|Q9Y3B3|TMED7_HUMAN Transmembrane emp24 domain-containing protein 7 OS=Homo sapiens GN=TMED7 PE=1 SV=2 20 207 2.0E-19
sp|D3ZTX0|TMED7_RAT Transmembrane emp24 domain-containing protein 7 OS=Rattus norvegicus GN=Tmed7 PE=1 SV=1 23 207 5.0E-19
sp|Q78IS1|TMED3_MOUSE Transmembrane emp24 domain-containing protein 3 OS=Mus musculus GN=Tmed3 PE=1 SV=1 23 207 6.0E-16
sp|Q9Y3Q3|TMED3_HUMAN Transmembrane emp24 domain-containing protein 3 OS=Homo sapiens GN=TMED3 PE=1 SV=1 23 207 1.0E-15
sp|Q28BQ6|TMED1_XENTR Transmembrane emp24 domain-containing protein 1 OS=Xenopus tropicalis GN=tmed1 PE=2 SV=1 12 208 2.0E-15
sp|Q6AY25|TMED3_RAT Transmembrane emp24 domain-containing protein 3 OS=Rattus norvegicus GN=Tmed3 PE=1 SV=1 23 207 2.0E-15
sp|Q9I7K5|TMEDE_DROME Transmembrane emp24 domain-containing protein eca OS=Drosophila melanogaster GN=eca PE=2 SV=2 1 207 5.0E-13
sp|B4LYB8|TMEDE_DROVI Transmembrane emp24 domain-containing protein eca OS=Drosophila virilis GN=eca PE=3 SV=1 11 207 8.0E-13
sp|B4QWH9|TMEDE_DROSI Transmembrane emp24 domain-containing protein eca OS=Drosophila simulans GN=eca PE=3 SV=1 1 207 8.0E-13
sp|B4HJV5|TMEDE_DROSE Transmembrane emp24 domain-containing protein eca OS=Drosophila sechellia GN=eca PE=3 SV=1 1 207 1.0E-12
sp|B4JG34|TMEDE_DROGR Transmembrane emp24 domain-containing protein eca OS=Drosophila grimshawi GN=eca PE=3 SV=1 1 207 1.0E-12
sp|B4NKL0|TMEDE_DROWI Transmembrane emp24 domain-containing protein eca OS=Drosophila willistoni GN=eca PE=3 SV=1 1 207 1.0E-12
sp|B4PVC6|TMEDE_DROYA Transmembrane emp24 domain-containing protein eca OS=Drosophila yakuba GN=eca PE=3 SV=1 1 207 2.0E-12
sp|B3NZM5|TMEDE_DROER Transmembrane emp24 domain-containing protein eca OS=Drosophila erecta GN=eca PE=3 SV=1 1 207 2.0E-12
sp|Q9Y3A6|TMED5_HUMAN Transmembrane emp24 domain-containing protein 5 OS=Homo sapiens GN=TMED5 PE=1 SV=1 16 208 2.0E-12
sp|B4KB41|TMEDE_DROMO Transmembrane emp24 domain-containing protein eca OS=Drosophila mojavensis GN=eca PE=3 SV=1 11 207 2.0E-12
sp|Q6AXN3|TMED5_RAT Transmembrane emp24 domain-containing protein 5 OS=Rattus norvegicus GN=Tmed5 PE=2 SV=1 3 208 3.0E-12
sp|Q5R809|TMED5_PONAB Transmembrane emp24 domain-containing protein 5 OS=Pongo abelii GN=TMED5 PE=2 SV=1 16 208 4.0E-12
sp|Q295B2|TMEDE_DROPS Transmembrane emp24 domain-containing protein eca OS=Drosophila pseudoobscura pseudoobscura GN=eca PE=3 SV=1 20 207 5.0E-12
sp|B4GMC3|TMEDE_DROPE Transmembrane emp24 domain-containing protein eca OS=Drosophila persimilis GN=eca PE=3 SV=1 20 207 5.0E-12
sp|B3MTS8|TMEDE_DROAN Transmembrane emp24 domain-containing protein eca OS=Drosophila ananassae GN=eca PE=3 SV=1 20 207 6.0E-12
sp|Q9CXE7|TMED5_MOUSE Transmembrane emp24 domain-containing protein 5 OS=Mus musculus GN=Tmed5 PE=1 SV=1 16 208 6.0E-12
sp|Q9BVK6|TMED9_HUMAN Transmembrane emp24 domain-containing protein 9 OS=Homo sapiens GN=TMED9 PE=1 SV=2 13 207 7.0E-12
sp|Q99KF1|TMED9_MOUSE Transmembrane emp24 domain-containing protein 9 OS=Mus musculus GN=Tmed9 PE=1 SV=2 20 207 1.0E-11
sp|Q3T133|TMED9_BOVIN Transmembrane emp24 domain-containing protein 9 OS=Bos taurus GN=TMED9 PE=1 SV=1 22 207 2.0E-11
sp|Q5I0E7|TMED9_RAT Transmembrane emp24 domain-containing protein 9 OS=Rattus norvegicus GN=Tmed9 PE=1 SV=1 22 207 2.0E-11
sp|Q2KJ84|TMED5_BOVIN Transmembrane emp24 domain-containing protein 5 OS=Bos taurus GN=TMED5 PE=2 SV=1 16 208 3.0E-11
sp|Q8R1V4|TMED4_MOUSE Transmembrane emp24 domain-containing protein 4 OS=Mus musculus GN=Tmed4 PE=1 SV=1 11 207 2.0E-09
sp|Q7Z7H5|TMED4_HUMAN Transmembrane emp24 domain-containing protein 4 OS=Homo sapiens GN=TMED4 PE=1 SV=1 20 207 2.0E-09
sp|Q9LIL4|P24B3_ARATH Transmembrane emp24 domain-containing protein p24beta3 OS=Arabidopsis thaliana GN=At3g22845 PE=2 SV=1 60 203 2.0E-08
sp|Q2TBK5|TMED1_BOVIN Transmembrane emp24 domain-containing protein 1 OS=Bos taurus GN=TMED1 PE=2 SV=1 24 113 4.0E-08
sp|Q5R7E6|TMED1_PONAB Transmembrane emp24 domain-containing protein 1 OS=Pongo abelii GN=TMED1 PE=2 SV=1 3 113 4.0E-08
sp|P32803|EMP24_YEAST Endosomal protein P24B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP24 PE=1 SV=1 20 204 5.0E-08
sp|Q13445|TMED1_HUMAN Transmembrane emp24 domain-containing protein 1 OS=Homo sapiens GN=TMED1 PE=1 SV=1 24 113 5.0E-08
sp|Q3V009|TMED1_MOUSE Transmembrane emp24 domain-containing protein 1 OS=Mus musculus GN=Tmed1 PE=1 SV=1 24 113 8.0E-08
sp|Q5BK85|TMED1_RAT Transmembrane emp24 domain-containing protein 1 OS=Rattus norvegicus GN=Tmed1 PE=2 SV=1 24 113 8.0E-08
sp|Q9FVU0|P24D4_ARATH Transmembrane emp24 domain-containing protein p24delta4 OS=Arabidopsis thaliana GN=CYB PE=1 SV=1 3 207 1.0E-07
sp|Q9P7I9|EMP24_SCHPO Endosomal protein P24B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=emp24 PE=3 SV=1 31 207 2.0E-06
sp|P38819|ERP5_YEAST Protein ERP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP5 PE=1 SV=1 6 203 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 177 199 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 295.27 158.70 431.85
CcL In ants, during behavior modification 352.39 178.62 526.15
CcD In ants, recently dead 346.93 183.72 510.14

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.491523 no
SC16a CcD 0.523935 no
CcL CcD 0.957744 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5451
MRLPTIAAGAFACLATNVVATALTYKVDAGEQACFYAETQKENEKIAFYFAVQSGGSFDVDYRVEGPGSKVILEG
EKERQGDFVFSAQQIGEYSFCFDNEMSTFTEKMIDIEISSEHESRTAQLPSKQGTSPEQTTVLEESIFKISGQMS
TISRNQKYFRTRENRNFSTVNSTEKRIVNFSMIQICLIVCMGALQVLVVRFFFQGARKGYV
Coding >Ophio5|5451
ATGAGACTACCAACTATCGCGGCGGGCGCCTTCGCTTGCCTGGCTACCAATGTCGTCGCCACGGCGTTGACGTAC
AAGGTGGACGCTGGCGAGCAGGCGTGCTTCTACGCCGAGACTCAAAAGGAGAACGAGAAGATTGCCTTCTATTTT
GCGGTTCAATCCGGCGGCTCGTTCGACGTCGATTACCGTGTCGAGGGCCCGGGGTCCAAGGTCATCCTCGAGGGC
GAGAAGGAGCGTCAAGGCGATTTCGTTTTCTCGGCGCAACAAATCGGCGAATACTCATTTTGCTTCGATAACGAG
ATGAGTACCTTTACAGAGAAGATGATTGACATCGAAATCTCGAGCGAGCACGAGTCCCGCACGGCGCAGTTGCCA
TCCAAGCAGGGAACGTCTCCCGAGCAGACGACCGTGCTGGAGGAGTCCATCTTCAAGATTTCGGGCCAAATGTCC
ACCATCTCGCGCAATCAGAAATACTTTCGGACCCGGGAGAATCGCAACTTTAGCACCGTCAACAGCACAGAGAAG
CGGATTGTCAACTTCAGTATGATTCAGATTTGTCTTATCGTGTGCATGGGCGCCCTGCAGGTGCTTGTTGTCAGG
TTCTTCTTCCAGGGAGCACGCAAAGGTTACGTA
Transcript >Ophio5|5451
ATGAGACTACCAACTATCGCGGCGGGCGCCTTCGCTTGCCTGGCTACCAATGTCGTCGCCACGGCGTTGACGTAC
AAGGTGGACGCTGGCGAGCAGGCGTGCTTCTACGCCGAGACTCAAAAGGAGAACGAGAAGATTGCCTTCTATTTT
GCGGTTCAATCCGGCGGCTCGTTCGACGTCGATTACCGTGTCGAGGGCCCGGGGTCCAAGGTCATCCTCGAGGGC
GAGAAGGAGCGTCAAGGCGATTTCGTTTTCTCGGCGCAACAAATCGGCGAATACTCATTTTGCTTCGATAACGAG
ATGAGTACCTTTACAGAGAAGATGATTGACATCGAAATCTCGAGCGAGCACGAGTCCCGCACGGCGCAGTTGCCA
TCCAAGCAGGGAACGTCTCCCGAGCAGACGACCGTGCTGGAGGAGTCCATCTTCAAGATTTCGGGCCAAATGTCC
ACCATCTCGCGCAATCAGAAATACTTTCGGACCCGGGAGAATCGCAACTTTAGCACCGTCAACAGCACAGAGAAG
CGGATTGTCAACTTCAGTATGATTCAGATTTGTCTTATCGTGTGCATGGGCGCCCTGCAGGTGCTTGTTGTCAGG
TTCTTCTTCCAGGGAGCACGCAAAGGTTACGTATGA
Gene >Ophio5|5451
ATGAGACTACCAACTATCGCGGCGGGCGCCTTCGCTTGCCTGGCTACCAATGTCGTCGCCACGGCGTTGACGTAC
AAGGTGGACGCTGGCGAGCAGGCGTGCTTCTACGCCGAGACTCAAAAGGAGAACGAGAAGATTGCCTTCTATTTT
GCGGTTGGTGCTTCTGCTCTGATACTCCTGGGCGCTGTAACTCACTCTCGTTGCTCCGCAGGTTCAATCCGGCGG
CTCGTTCGACGTCGATTACCGTGTCGAGGGCCCGGGGTCCAAGGTCATCCTCGAGGGCGAGAAGGAGCGTCAAGG
CGATTTCGTTTTCTCGGCGCAACAAATCGGCGAATACTCATTTTGCTTCGATAACGAGATGAGTACCTTTACAGA
GAAGATGATTGACATCGAAATCTCGGTCCGTCAAGCCAGTGGCCCTGCCATCGAATGGAGTCGTGCTGATCTTCT
TCCCACTCAGAGCGAGCACGAGTCCCGCACGGCGCAGTTGCCATCCAAGCAGGGAACGTCTCCCGAGCAGACGAC
CGTGCTGGAGGAGTCCATCTTCAAGATTTCGGGCCAAATGTCCACCATCTCGCGCAATCAGAAATACTTTCGGAC
CCGGGAGAATCGCAACTTTAGCACCGTCAACAGCACAGAGAAGCGGATTGTCAACTTCAGTATGATTCAGATTTG
TCTTATCGTGTGCATGGGCGCCCTGCAGGTGCTTGTTGTCAGGTTCTTCTTCCAGGTACGTCTTCACGAGCCTAT
GCCGAACGAGGACCCGGCCTGACGGCGTCTTCACGATTAGGGAGCACGCAAAGGTTACGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail