Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5445
Gene name
Locationscaffold_445:4789..8078
Strand+
Gene length (bp)3289
Transcript length (bp)2880
Coding sequence length (bp)2877
Protein length (aa) 959

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10277 Frag1 Frag1/DRAM/Sfk1 family 5.6E-38 19 226

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25618|CWH43_YEAST Protein CWH43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWH43 PE=1 SV=2 17 958 0.0E+00
sp|Q9HDZ2|CWH43_SCHPO Protein cwh43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwh43 PE=2 SV=2 16 959 0.0E+00
sp|Q9H720|PG2IP_HUMAN PGAP2-interacting protein OS=Homo sapiens GN=CWH43 PE=2 SV=2 282 958 8.0E-88
sp|Q91YL7|PG2IP_MOUSE PGAP2-interacting protein OS=Mus musculus GN=Cwh43 PE=1 SV=1 275 958 7.0E-83
sp|Q2ABP2|PGAP2_CRIGR Post-GPI attachment to proteins factor 2 OS=Cricetulus griseus GN=Pgap2 PE=2 SV=1 7 233 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25618|CWH43_YEAST Protein CWH43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWH43 PE=1 SV=2 17 958 0.0E+00
sp|Q9HDZ2|CWH43_SCHPO Protein cwh43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwh43 PE=2 SV=2 16 959 0.0E+00
sp|Q9H720|PG2IP_HUMAN PGAP2-interacting protein OS=Homo sapiens GN=CWH43 PE=2 SV=2 282 958 8.0E-88
sp|Q91YL7|PG2IP_MOUSE PGAP2-interacting protein OS=Mus musculus GN=Cwh43 PE=1 SV=1 275 958 7.0E-83
sp|Q2ABP2|PGAP2_CRIGR Post-GPI attachment to proteins factor 2 OS=Cricetulus griseus GN=Pgap2 PE=2 SV=1 7 233 3.0E-12
sp|Q2ABP3|PGAP2_RAT Post-GPI attachment to proteins factor 2 OS=Rattus norvegicus GN=Pgap2 PE=2 SV=1 7 233 8.0E-12
sp|Q3TQR0|PGAP2_MOUSE Post-GPI attachment to proteins factor 2 OS=Mus musculus GN=Pgap2 PE=1 SV=2 7 233 1.0E-11
sp|Q5M9A7|PGAP2_XENLA Post-GPI attachment to proteins factor 2 OS=Xenopus laevis GN=pgap2 PE=2 SV=1 7 231 3.0E-10
sp|A6H7B8|PGAP2_BOVIN Post-GPI attachment to proteins factor 2 OS=Bos taurus GN=PGAP2 PE=2 SV=1 7 233 7.0E-10
sp|Q9UHJ9|PGAP2_HUMAN Post-GPI attachment to proteins factor 2 OS=Homo sapiens GN=PGAP2 PE=1 SV=2 7 233 8.0E-10
sp|Q9VPT7|PGAP2_DROME Post-GPI attachment to proteins factor 2 OS=Drosophila melanogaster GN=CG3876 PE=2 SV=2 59 236 1.0E-08
sp|Q9VWK6|PGP2L_DROME Post-GPI attachment to proteins factor 2-like OS=Drosophila melanogaster GN=CG7990 PE=2 SV=4 62 235 2.0E-07
sp|Q29M88|PGAP2_DROPS Post-GPI attachment to proteins factor 2 OS=Drosophila pseudoobscura pseudoobscura GN=GA17744 PE=3 SV=2 59 236 2.0E-07
sp|A8KBG2|PGAP2_XENTR Post-GPI attachment to proteins factor 2 OS=Xenopus tropicalis GN=pgap2 PE=2 SV=1 32 231 5.0E-07
sp|A8XST1|PGAP2_CAEBR Post-GPI attachment to proteins factor 2 OS=Caenorhabditis briggsae GN=tag-189 PE=3 SV=2 28 238 9.0E-07
sp|Q22141|PGAP2_CAEEL Post-GPI attachment to proteins factor 2 OS=Caenorhabditis elegans GN=tag-189 PE=3 SV=2 28 236 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 78 100 22
3 107 129 22
4 139 158 19
5 171 188 17
6 198 216 18
7 277 299 22
8 334 351 17
9 358 375 17
10 390 407 17
11 420 439 19
12 454 476 22
13 496 518 22
14 546 568 22
15 575 597 22
16 612 629 17
17 649 666 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5445
MATRYKDKDAGVVVSFGGQWVSWAHTVIASTAFLSALVVGLALHYRKIVQNEFYGYPDEWFPSVSAAIGDRYPER
SVFMVFIAVTSGPRFALVGLWYLLTRKHGSRLPGFVASMGFLRTLTCGGWTYITSTDDHDWHDILMISYIVATLP
WTTGCIALSPPNAQAIKYRKYLASAFFGTLVPLIYFFIRHKVHRVAGAYTIYAFFEWALIVFDVAFDAVTALDFH
TFEVLVKDVRGSTKGEAPSSMSSAVLEKEKYKATGGVYSLHFTWSEALDIAASVYHGFIFWSMLTSLGLLVWYFP
LWHMGISGYEAFVLVSASPALLVGPLRSLAANNARIVHLLSLVGVAAYLVADPARRLLTVGVGVALSTLGWVATL
HSESAHERRFESRLLGLMIGLILSSTAKFAWQTNNPIWPVLHAENGGWNATGLVLGVLAALRFTRHAPMTGGLSL
GGKPGGSAILAACGIGGLFFGLHSLLSDTSTMILWVWEGFPIRGPYFSTHGWCTVAAMTAGLGAGIWRPTLAGSW
TQYAAGTLGAMVLTKFSHWLGYLGGLGLAVYLMAVSVPLISSASKKNPAVTFGLGFLIYVFLVLFHVWVVAYAFV
PGGPLVREHTDWVMATMMALIGAGVADFNASQPRRQPPASPLASQHRKYYGVAALIVNILFLCAAFKRFPRTDHK
PYHAEDRIMTAGIWTVHFSLDNDMWSSEYRMRDLIKELELDVVGLLESDLQRVIMGNRDTTQFLAEDLGMYVDYG
PGPNKHTWGAALLSKFPIIESKHHLLPSPVGELAPAIHATLDVYGELVDVFVFHSGQEEDPEDRRLQSEYLSNLM
GSSPRPSVLLSYLVTKPLEGNYNTYVSNQSGMHDIDWTDWDRWCEYILYKGLRRVGYARVSRSTITDTELQAGKF
VIPSSAAERAQLEARPAEERDRRVQESEVPEGWRFPALFRGDGVRNHRYHVFDEPRYFN
Coding >Ophio5|5445
ATGGCGACCCGATACAAGGACAAGGACGCTGGCGTCGTCGTCAGCTTCGGTGGCCAGTGGGTGAGCTGGGCACAT
ACAGTCATTGCCTCGACCGCTTTCCTGAGCGCCCTGGTCGTCGGCCTCGCCTTGCACTACCGGAAAATCGTCCAG
AACGAGTTCTACGGCTACCCCGACGAATGGTTCCCCTCGGTCTCGGCCGCCATCGGTGACCGATATCCCGAGCGG
TCGGTTTTCATGGTCTTTATCGCCGTAACGTCTGGTCCACGCTTCGCTCTCGTCGGCTTGTGGTATCTCTTGACA
CGAAAGCATGGGTCCAGGCTCCCCGGCTTCGTCGCCTCAATGGGCTTCCTTCGCACCCTGACCTGCGGTGGTTGG
ACCTACATCACATCGACCGACGACCACGACTGGCATGACATTCTCATGATCTCTTATATTGTCGCCACGCTGCCG
TGGACCACTGGCTGCATCGCATTGAGCCCCCCAAACGCACAGGCCATCAAGTATCGCAAATATCTTGCCAGCGCC
TTCTTCGGAACCCTCGTTCCGCTCATTTACTTCTTTATTCGGCACAAAGTCCATCGCGTGGCGGGAGCCTATACC
ATCTACGCCTTTTTTGAATGGGCACTCATTGTCTTCGACGTGGCATTTGACGCCGTCACGGCTCTCGACTTCCAT
ACGTTTGAGGTCCTGGTGAAAGACGTCAGGGGATCGACCAAGGGTGAAGCGCCGTCTTCCATGTCGTCTGCCGTC
TTGGAGAAGGAGAAATACAAGGCAACAGGCGGCGTCTACTCACTTCATTTCACATGGTCCGAGGCCTTGGACATT
GCGGCGAGTGTCTACCATGGTTTCATCTTCTGGTCCATGTTGACCAGCTTGGGCCTACTCGTCTGGTACTTTCCC
CTCTGGCACATGGGCATCTCCGGATACGAGGCCTTCGTACTGGTTTCCGCCTCGCCGGCACTTTTGGTCGGTCCC
CTCCGATCGTTGGCGGCCAACAACGCGCGCATTGTTCACCTGCTGTCGCTCGTCGGCGTCGCCGCATATCTCGTC
GCCGACCCAGCCCGTCGTCTCTTAACCGTCGGGGTTGGAGTCGCTCTGTCGACCTTGGGCTGGGTCGCTACCCTA
CACTCGGAATCCGCTCATGAGAGGCGGTTCGAGTCGAGGCTGCTGGGCCTGATGATCGGTTTGATCCTGTCTTCG
ACTGCCAAGTTCGCTTGGCAGACAAACAACCCTATATGGCCCGTCTTGCACGCCGAAAACGGGGGCTGGAACGCC
ACGGGCCTCGTCCTCGGCGTTTTGGCCGCGCTCCGCTTCACCCGTCATGCGCCTATGACTGGCGGTCTCTCCCTT
GGGGGCAAGCCGGGGGGCTCGGCCATCCTCGCCGCCTGTGGCATCGGCGGCCTGTTCTTTGGCCTCCACTCGCTG
CTTTCCGACACGAGCACCATGATCCTCTGGGTCTGGGAAGGGTTCCCCATCCGCGGCCCATACTTCTCCACGCAC
GGCTGGTGCACCGTGGCTGCCATGACGGCCGGCCTCGGCGCTGGTATCTGGAGACCTACTCTGGCGGGCAGCTGG
ACGCAGTACGCCGCGGGAACGCTCGGCGCCATGGTCCTGACGAAATTCAGCCACTGGCTCGGCTATCTGGGCGGT
CTCGGCCTGGCGGTGTATCTGATGGCCGTCTCCGTGCCCCTGATTTCCAGCGCGTCCAAGAAGAATCCGGCAGTG
ACGTTTGGGCTGGGGTTCCTCATCTACGTCTTCCTGGTCCTGTTCCACGTTTGGGTTGTCGCCTATGCCTTTGTG
CCCGGCGGACCGCTCGTTCGCGAGCACACAGACTGGGTCATGGCCACCATGATGGCTCTGATTGGCGCAGGCGTG
GCGGACTTTAACGCTTCGCAACCACGACGGCAACCACCGGCGAGCCCTCTGGCGTCACAACACAGGAAATACTAC
GGAGTCGCGGCGCTCATCGTCAACATCCTCTTCCTTTGCGCGGCATTCAAACGGTTTCCCAGGACTGACCACAAG
CCCTACCACGCCGAGGATCGCATCATGACGGCCGGCATCTGGACCGTTCACTTCTCCCTGGACAACGACATGTGG
TCGTCCGAGTACCGCATGCGCGACTTGATCAAGGAGCTGGAGCTGGATGTGGTCGGCCTCCTCGAGTCGGATCTG
CAGCGCGTCATCATGGGCAACCGCGACACGACACAGTTCCTGGCGGAGGATCTCGGCATGTACGTCGATTACGGG
CCCGGCCCGAACAAGCACACATGGGGTGCGGCTCTGCTGTCCAAGTTCCCGATCATCGAGTCCAAGCACCACCTC
CTGCCGAGTCCGGTGGGCGAGCTGGCGCCCGCCATCCACGCGACGCTGGACGTCTATGGCGAGCTGGTCGACGTC
TTCGTCTTCCACTCGGGACAGGAAGAGGACCCGGAGGACCGAAGACTGCAGAGCGAATACCTCAGCAACCTGATG
GGCTCGAGCCCGCGGCCGTCGGTGCTACTCAGCTATCTGGTGACGAAGCCGCTCGAGGGCAACTACAACACGTAC
GTGAGCAACCAATCGGGCATGCACGACATCGACTGGACCGACTGGGACCGGTGGTGCGAATACATACTGTACAAG
GGCCTCCGCCGGGTGGGCTATGCGCGCGTGAGTCGCAGCACCATCACCGACACGGAGCTCCAAGCGGGCAAGTTT
GTCATTCCCAGCTCTGCCGCGGAGAGGGCGCAGCTGGAAGCGCGACCGGCCGAGGAACGCGACCGGCGCGTGCAG
GAGTCGGAGGTGCCCGAGGGATGGAGGTTCCCGGCCCTGTTTAGGGGGGACGGCGTGCGGAATCACCGATACCAT
GTTTTTGATGAGCCGAGGTATTTTAAC
Transcript >Ophio5|5445
ATGGCGACCCGATACAAGGACAAGGACGCTGGCGTCGTCGTCAGCTTCGGTGGCCAGTGGGTGAGCTGGGCACAT
ACAGTCATTGCCTCGACCGCTTTCCTGAGCGCCCTGGTCGTCGGCCTCGCCTTGCACTACCGGAAAATCGTCCAG
AACGAGTTCTACGGCTACCCCGACGAATGGTTCCCCTCGGTCTCGGCCGCCATCGGTGACCGATATCCCGAGCGG
TCGGTTTTCATGGTCTTTATCGCCGTAACGTCTGGTCCACGCTTCGCTCTCGTCGGCTTGTGGTATCTCTTGACA
CGAAAGCATGGGTCCAGGCTCCCCGGCTTCGTCGCCTCAATGGGCTTCCTTCGCACCCTGACCTGCGGTGGTTGG
ACCTACATCACATCGACCGACGACCACGACTGGCATGACATTCTCATGATCTCTTATATTGTCGCCACGCTGCCG
TGGACCACTGGCTGCATCGCATTGAGCCCCCCAAACGCACAGGCCATCAAGTATCGCAAATATCTTGCCAGCGCC
TTCTTCGGAACCCTCGTTCCGCTCATTTACTTCTTTATTCGGCACAAAGTCCATCGCGTGGCGGGAGCCTATACC
ATCTACGCCTTTTTTGAATGGGCACTCATTGTCTTCGACGTGGCATTTGACGCCGTCACGGCTCTCGACTTCCAT
ACGTTTGAGGTCCTGGTGAAAGACGTCAGGGGATCGACCAAGGGTGAAGCGCCGTCTTCCATGTCGTCTGCCGTC
TTGGAGAAGGAGAAATACAAGGCAACAGGCGGCGTCTACTCACTTCATTTCACATGGTCCGAGGCCTTGGACATT
GCGGCGAGTGTCTACCATGGTTTCATCTTCTGGTCCATGTTGACCAGCTTGGGCCTACTCGTCTGGTACTTTCCC
CTCTGGCACATGGGCATCTCCGGATACGAGGCCTTCGTACTGGTTTCCGCCTCGCCGGCACTTTTGGTCGGTCCC
CTCCGATCGTTGGCGGCCAACAACGCGCGCATTGTTCACCTGCTGTCGCTCGTCGGCGTCGCCGCATATCTCGTC
GCCGACCCAGCCCGTCGTCTCTTAACCGTCGGGGTTGGAGTCGCTCTGTCGACCTTGGGCTGGGTCGCTACCCTA
CACTCGGAATCCGCTCATGAGAGGCGGTTCGAGTCGAGGCTGCTGGGCCTGATGATCGGTTTGATCCTGTCTTCG
ACTGCCAAGTTCGCTTGGCAGACAAACAACCCTATATGGCCCGTCTTGCACGCCGAAAACGGGGGCTGGAACGCC
ACGGGCCTCGTCCTCGGCGTTTTGGCCGCGCTCCGCTTCACCCGTCATGCGCCTATGACTGGCGGTCTCTCCCTT
GGGGGCAAGCCGGGGGGCTCGGCCATCCTCGCCGCCTGTGGCATCGGCGGCCTGTTCTTTGGCCTCCACTCGCTG
CTTTCCGACACGAGCACCATGATCCTCTGGGTCTGGGAAGGGTTCCCCATCCGCGGCCCATACTTCTCCACGCAC
GGCTGGTGCACCGTGGCTGCCATGACGGCCGGCCTCGGCGCTGGTATCTGGAGACCTACTCTGGCGGGCAGCTGG
ACGCAGTACGCCGCGGGAACGCTCGGCGCCATGGTCCTGACGAAATTCAGCCACTGGCTCGGCTATCTGGGCGGT
CTCGGCCTGGCGGTGTATCTGATGGCCGTCTCCGTGCCCCTGATTTCCAGCGCGTCCAAGAAGAATCCGGCAGTG
ACGTTTGGGCTGGGGTTCCTCATCTACGTCTTCCTGGTCCTGTTCCACGTTTGGGTTGTCGCCTATGCCTTTGTG
CCCGGCGGACCGCTCGTTCGCGAGCACACAGACTGGGTCATGGCCACCATGATGGCTCTGATTGGCGCAGGCGTG
GCGGACTTTAACGCTTCGCAACCACGACGGCAACCACCGGCGAGCCCTCTGGCGTCACAACACAGGAAATACTAC
GGAGTCGCGGCGCTCATCGTCAACATCCTCTTCCTTTGCGCGGCATTCAAACGGTTTCCCAGGACTGACCACAAG
CCCTACCACGCCGAGGATCGCATCATGACGGCCGGCATCTGGACCGTTCACTTCTCCCTGGACAACGACATGTGG
TCGTCCGAGTACCGCATGCGCGACTTGATCAAGGAGCTGGAGCTGGATGTGGTCGGCCTCCTCGAGTCGGATCTG
CAGCGCGTCATCATGGGCAACCGCGACACGACACAGTTCCTGGCGGAGGATCTCGGCATGTACGTCGATTACGGG
CCCGGCCCGAACAAGCACACATGGGGTGCGGCTCTGCTGTCCAAGTTCCCGATCATCGAGTCCAAGCACCACCTC
CTGCCGAGTCCGGTGGGCGAGCTGGCGCCCGCCATCCACGCGACGCTGGACGTCTATGGCGAGCTGGTCGACGTC
TTCGTCTTCCACTCGGGACAGGAAGAGGACCCGGAGGACCGAAGACTGCAGAGCGAATACCTCAGCAACCTGATG
GGCTCGAGCCCGCGGCCGTCGGTGCTACTCAGCTATCTGGTGACGAAGCCGCTCGAGGGCAACTACAACACGTAC
GTGAGCAACCAATCGGGCATGCACGACATCGACTGGACCGACTGGGACCGGTGGTGCGAATACATACTGTACAAG
GGCCTCCGCCGGGTGGGCTATGCGCGCGTGAGTCGCAGCACCATCACCGACACGGAGCTCCAAGCGGGCAAGTTT
GTCATTCCCAGCTCTGCCGCGGAGAGGGCGCAGCTGGAAGCGCGACCGGCCGAGGAACGCGACCGGCGCGTGCAG
GAGTCGGAGGTGCCCGAGGGATGGAGGTTCCCGGCCCTGTTTAGGGGGGACGGCGTGCGGAATCACCGATACCAT
GTTTTTGATGAGCCGAGGTATTTTAACTAG
Gene >Ophio5|5445
ATGGCGACCCGATACAAGGACAAGGACGCTGGCGTCGTCGTCAGCTTCGGTGGCCAGTGGGTGAGCTGGGCACAT
ACAGTCATTGCCTCGAGTGAGTCGCGGCCGCCGTCTGCAAGCAAAGGTCAACCGATACTGATGGATGCTGTGTAG
CCGCTTTCCTGAGCGCCCTGGTCGTCGGCCTCGCCTTGCACTACCGGAAAATCGTCCAGAACGAGTTCTACGGCT
ACCCCGACGAATGGTTCCCCTCGGTCTCGGCCGCCATCGGTGACCGATATCCCGAGCGGTCGGTTTTCATGGTCT
TTATCGCCGTAACGTCTGGTACGCTCCTCCATCTACGTCCGCTGCGACGCTACCGGGTCTAACTCGTCCAGGTCC
ACGCTTCGCTCTCGTCGGCTTGTGGTATCTCTTGACACGAAAGCATGGGTCCAGGCTCCCCGGCTTCGTCGCCTC
AATGGGCTTCCTTCGCACCCTGACCTGCGGTGGTTGGACCTACATCACATCGACCGACGACCACGACTGGCATGA
CATTCTCATGATCTCTTATATTGTCGCCACGCTGCCGTGGACCACTGGCTGCATCGCATTGAGCCCCCCAAACGC
ACAGGCCATCAAGTATCGCAAATATCTTGCCAGCGCCTTCTTCGGAACCCTCGTTCCGCTCATTTACTTCTTTAT
TCGGCACAAAGTCCATCGCGTGGCGGGAGGTAATTCGCTCCGACCAAATCGTGGCCGCGGCAACGCTGACTTGCG
CAGCCTATACCATCTACGCCTTTTTTGAATGGGCACTCATTGTCTTCGACGTGGCATTTGACGCCGTCACGGCTC
TCGACTTCCATACGTTTGAGGTCCTGGTGAAAGACGTCAGGGGATCGACCAAGGGGTACGTGCAATGGCTCCCGA
GATAGCACTCGCTTCTTGTACAGTCACCCCCAATATACTTGCTTCCCGCCCATCGTATCTAAAGTCATCCTGCAG
TGAAGCGCCGTCTTCCATGTCGTCTGCCGTCTTGGAGAAGGAGTAAGTTTTTACCCGCGTGAGGGATGACGCACT
ACTAACGAGACGTCAAGGAAATACAAGGCAACAGGCGGCGTCTACTCACTTCATTTCACATGGTCCGAGGCCTTG
GACATTGCGGCGAGTGTCTACCATGGTGTAAGTAGGAGCTCTACCTGGCGCCAGTGCCTCGTATCTGACGCCTGA
CAGTTCATCTTCTGGTCCATGTTGACCAGCTTGGGCCTACTCGTCTGGTGTAAGTTGTCCCTACCTCGCCTTCTC
CCCAGACGGCGACTTACAGCTTCAAGACTTTCCCCTCTGGCACATGGGCATCTCCGGATACGAGGCCTTCGTACT
GGTTTCCGCCTCGCCGGCACTTTTGGTCGGTCCCCTCCGATCGTTGGCGGCCAACAACGCGCGCATTGTTCACCT
GCTGTCGCTCGTCGGCGTCGCCGCATATCTCGTCGCCGACCCAGCCCGTCGTCTCTTAACCGTCGGGGTTGGAGT
CGCTCTGTCGACCTTGGGCTGGGTCGCTACCCTACACTCGGAATCCGCTCATGAGAGGCGGTTCGAGTCGAGGCT
GCTGGGCCTGATGATCGGTTTGATCCTGTCTTCGACTGCCAAGTTCGCTTGGCAGACAAACAACCCTATATGGCC
CGTCTTGCACGCCGAAAACGGGGGCTGGAACGCCACGGGCCTCGTCCTCGGCGTTTTGGCCGCGCTCCGCTTCAC
CCGTCATGCGCCTATGACTGGCGGTCTCTCCCTTGGGGGCAAGCCGGGGGGCTCGGCCATCCTCGCCGCCTGTGG
CATCGGCGGCCTGTTCTTTGGCCTCCACTCGCTGCTTTCCGACACGAGCACCATGATCCTCTGGGTCTGGGAAGG
GTTCCCCATCCGCGGCCCATACTTCTCCACGCACGGCTGGTGCACCGTGGCTGCCATGACGGCCGGCCTCGGCGC
TGGTATCTGGAGACCTACTCTGGCGGGCAGCTGGACGCAGTACGCCGCGGGAACGCTCGGCGCCATGGTCCTGAC
GAAATTCAGCCACTGGCTCGGCTATCTGGGCGGTCTCGGCCTGGCGGTGTATCTGATGGCCGTCTCCGTGCCCCT
GATTTCCAGCGCGTCCAAGAAGAATCCGGCAGTGACGTTTGGGCTGGGGTTCCTCATCTACGTCTTCCTGGTCCT
GTTCCACGTTTGGGTTGTCGCCTATGCCTTTGTGCCCGGCGGACCGCTCGTTCGCGAGCACACAGACTGGGTCAT
GGCCACCATGATGGCTCTGATTGGCGCAGGCGTGGCGGACTTTAACGCTTCGCAACCACGACGGCAACCACCGGC
GAGCCCTCTGGCGTCACAACACAGGAAATACTACGGAGTCGCGGCGCTCATCGTCAACATCCTCTTCCTTTGCGC
GGCATTCAAACGGTTTCCCAGGACTGACCACAAGCCCTACCACGCCGAGGATCGCATCATGACGGCCGGCATCTG
GACCGTTCACTTCTCCCTGGACAACGACATGTGGTCGTCCGAGTACCGCATGCGCGACTTGATCAAGGAGCTGGA
GCTGGATGTGGTCGGCCTCCTCGAGTCGGATCTGCAGCGCGTCATCATGGGCAACCGCGACACGACACAGTTCCT
GGCGGAGGATCTCGGCATGTACGTCGATTACGGGCCCGGCCCGAACAAGCACACATGGGGTGCGGCTCTGCTGTC
CAAGTTCCCGATCATCGAGTCCAAGCACCACCTCCTGCCGAGTCCGGTGGGCGAGCTGGCGCCCGCCATCCACGC
GACGCTGGACGTCTATGGCGAGCTGGTCGACGTCTTCGTCTTCCACTCGGGACAGGAAGAGGACCCGGAGGACCG
AAGACTGCAGAGCGAATACCTCAGCAACCTGATGGGCTCGAGCCCGCGGCCGTCGGTGCTACTCAGCTATCTGGT
GACGAAGCCGCTCGAGGGCAACTACAACACGTACGTGAGCAACCAATCGGGCATGCACGACATCGACTGGACCGA
CTGGGACCGGTGGTGCGAATACATACTGTACAAGGGCCTCCGCCGGGTGGGCTATGCGCGCGTGAGTCGCAGCAC
CATCACCGACACGGAGCTCCAAGCGGGCAAGTTTGTCATTCCCAGCTCTGCCGCGGAGAGGGCGCAGCTGGAAGC
GCGACCGGCCGAGGAACGCGACCGGCGCGTGCAGGAGTCGGAGGTGCCCGAGGGATGGAGGTTCCCGGCCCTGTT
TAGGGGGGACGGCGTGCGGAATCACCGATACCATGTTTTTGATGAGCCGAGGTATTTTAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail