Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5444
Gene name
Locationscaffold_445:2797..4083
Strand-
Gene length (bp)1286
Transcript length (bp)1212
Coding sequence length (bp)1209
Protein length (aa) 403

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08640 U3_assoc_6 U3 small nucleolar RNA-associated protein 6 8.5E-26 12 80

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q02354|UTP6_YEAST U3 small nucleolar RNA-associated protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP6 PE=1 SV=2 7 281 1.0E-31
sp|O60188|UTP6_SCHPO U3 small nucleolar RNA-associated protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp6 PE=3 SV=1 4 198 5.0E-30
sp|Q9NYH9|UTP6_HUMAN U3 small nucleolar RNA-associated protein 6 homolog OS=Homo sapiens GN=UTP6 PE=2 SV=2 12 216 5.0E-11
sp|Q8VCY6|UTP6_MOUSE U3 small nucleolar RNA-associated protein 6 homolog OS=Mus musculus GN=Utp6 PE=2 SV=1 12 216 6.0E-11
sp|Q54WN5|UTP6_DICDI U3 small nucleolar RNA-associated protein 6 homolog OS=Dictyostelium discoideum GN=utp6 PE=1 SV=1 15 191 3.0E-06

GO

GO Term Description Terminal node
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Yes
GO:0030515 snoRNA binding Yes
GO:0043170 macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0030490 maturation of SSU-rRNA No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0003676 nucleic acid binding No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0034470 ncRNA processing No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0006364 rRNA processing No
GO:0016070 RNA metabolic process No
GO:0006396 RNA processing No
GO:0097159 organic cyclic compound binding No
GO:0016072 rRNA metabolic process No
GO:0003723 RNA binding No
GO:0006807 nitrogen compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5444
MAGVAEKARFYLERSVPQLREWEEKEIFSKDEIRTIVQKRNDFELRVLSPGNKPSEWSSYAKWEQSLEALRTKRC
KRLKIRHLNPAYTGQSRVMTIYERSVNKHPSNGDLWREYLAYVATIKAAKRWRKTMTSALRMKPTDSELWIMAGR
RSAHNGDMASARSFFMRGCRFCTKDCGLWLEYARCEMQWLAKVDKRKEAPKTDALRPDRTDDGDELSLLGSDDDD
DDDEGNEDGEGGSGLPVASNARPNVIDQHSRQVLESNPAMDGAIPMAIFDIARKQVFFTPDFAETFFIMISSFRN
VSVQPKISQHVLDTMDTMYPNHPSTCSCHIRQPILGLSPHTAEFPRNLRDVLVRMTERLETTTDRPALVQKTMAW
MDEYLALDNLDKGIRAVLEHIKGKVADS
Coding >Ophio5|5444
ATGGCGGGTGTCGCAGAAAAGGCCAGGTTCTATCTCGAGCGATCGGTCCCGCAGCTTCGAGAGTGGGAAGAGAAG
GAAATCTTTTCCAAGGACGAAATCCGCACCATTGTCCAGAAGCGCAACGACTTTGAGCTCAGAGTTCTGTCTCCC
GGGAACAAGCCTTCCGAATGGTCCTCGTATGCCAAGTGGGAGCAGTCGCTCGAAGCGCTGCGAACCAAACGGTGC
AAGCGACTCAAGATACGCCACCTGAATCCAGCATATACCGGCCAGAGCCGCGTCATGACCATCTACGAGCGATCC
GTCAACAAACACCCATCCAACGGCGATTTGTGGCGCGAATATCTGGCCTACGTGGCCACCATCAAAGCCGCCAAG
CGATGGCGGAAGACCATGACCAGCGCCCTGCGCATGAAGCCGACCGACTCAGAGCTGTGGATCATGGCCGGCCGC
CGATCCGCGCATAACGGAGACATGGCGTCGGCGAGGAGCTTCTTCATGCGGGGGTGTCGGTTCTGCACAAAGGAT
TGCGGGCTGTGGCTCGAGTATGCTCGGTGCGAGATGCAATGGCTGGCCAAAGTGGACAAACGCAAGGAGGCACCG
AAAACCGATGCGCTGCGGCCGGACAGAACCGATGATGGCGACGAGCTGAGTCTTTTGGGTAGCGACGACGACGAC
GACGACGACGAAGGAAATGAGGACGGAGAGGGAGGAAGCGGATTGCCCGTCGCATCAAACGCGCGGCCCAATGTC
ATCGACCAGCACTCCCGCCAAGTGCTCGAATCGAATCCCGCCATGGATGGTGCCATCCCCATGGCCATATTTGAC
ATAGCACGGAAGCAAGTTTTCTTCACGCCAGACTTTGCAGAAACGTTTTTCATCATGATTTCCTCGTTTCGTAAC
GTCTCTGTACAGCCCAAGATTTCCCAGCACGTCCTGGACACCATGGACACCATGTACCCGAACCACCCGTCTACT
TGCAGCTGCCACATCCGGCAACCCATACTGGGGTTGAGTCCTCACACGGCCGAGTTTCCCCGGAACTTGCGAGAC
GTCCTGGTTCGCATGACAGAAAGGCTGGAAACGACGACGGACCGGCCAGCCCTGGTTCAGAAGACGATGGCGTGG
ATGGACGAATATCTCGCCTTGGACAATCTGGACAAGGGCATCAGGGCAGTTTTGGAACACATTAAAGGAAAAGTG
GCGGATTCA
Transcript >Ophio5|5444
ATGGCGGGTGTCGCAGAAAAGGCCAGGTTCTATCTCGAGCGATCGGTCCCGCAGCTTCGAGAGTGGGAAGAGAAG
GAAATCTTTTCCAAGGACGAAATCCGCACCATTGTCCAGAAGCGCAACGACTTTGAGCTCAGAGTTCTGTCTCCC
GGGAACAAGCCTTCCGAATGGTCCTCGTATGCCAAGTGGGAGCAGTCGCTCGAAGCGCTGCGAACCAAACGGTGC
AAGCGACTCAAGATACGCCACCTGAATCCAGCATATACCGGCCAGAGCCGCGTCATGACCATCTACGAGCGATCC
GTCAACAAACACCCATCCAACGGCGATTTGTGGCGCGAATATCTGGCCTACGTGGCCACCATCAAAGCCGCCAAG
CGATGGCGGAAGACCATGACCAGCGCCCTGCGCATGAAGCCGACCGACTCAGAGCTGTGGATCATGGCCGGCCGC
CGATCCGCGCATAACGGAGACATGGCGTCGGCGAGGAGCTTCTTCATGCGGGGGTGTCGGTTCTGCACAAAGGAT
TGCGGGCTGTGGCTCGAGTATGCTCGGTGCGAGATGCAATGGCTGGCCAAAGTGGACAAACGCAAGGAGGCACCG
AAAACCGATGCGCTGCGGCCGGACAGAACCGATGATGGCGACGAGCTGAGTCTTTTGGGTAGCGACGACGACGAC
GACGACGACGAAGGAAATGAGGACGGAGAGGGAGGAAGCGGATTGCCCGTCGCATCAAACGCGCGGCCCAATGTC
ATCGACCAGCACTCCCGCCAAGTGCTCGAATCGAATCCCGCCATGGATGGTGCCATCCCCATGGCCATATTTGAC
ATAGCACGGAAGCAAGTTTTCTTCACGCCAGACTTTGCAGAAACGTTTTTCATCATGATTTCCTCGTTTCGTAAC
GTCTCTGTACAGCCCAAGATTTCCCAGCACGTCCTGGACACCATGGACACCATGTACCCGAACCACCCGTCTACT
TGCAGCTGCCACATCCGGCAACCCATACTGGGGTTGAGTCCTCACACGGCCGAGTTTCCCCGGAACTTGCGAGAC
GTCCTGGTTCGCATGACAGAAAGGCTGGAAACGACGACGGACCGGCCAGCCCTGGTTCAGAAGACGATGGCGTGG
ATGGACGAATATCTCGCCTTGGACAATCTGGACAAGGGCATCAGGGCAGTTTTGGAACACATTAAAGGAAAAGTG
GCGGATTCATGA
Gene >Ophio5|5444
ATGGCGGGTGTCGCAGAAAAGGCCAGGTTCTATCTCGAGCGATCGGTCCCGCAGCTTCGAGAGTGGGAAGAGAAG
GAAATCTTTTCCAAGGCGTGTGCCTCCGCGCCTCTGCGCCTCTTACCTACCTCCTGCCCCCTGCCCTTCCTTGGC
TAATGCGCCACCAGGACGAAATCCGCACCATTGTCCAGAAGCGCAACGACTTTGAGCTCAGAGTTCTGTCTCCCG
GGAACAAGCCTTCCGAATGGTCCTCGTATGCCAAGTGGGAGCAGTCGCTCGAAGCGCTGCGAACCAAACGGTGCA
AGCGACTCAAGATACGCCACCTGAATCCAGCATATACCGGCCAGAGCCGCGTCATGACCATCTACGAGCGATCCG
TCAACAAACACCCATCCAACGGCGATTTGTGGCGCGAATATCTGGCCTACGTGGCCACCATCAAAGCCGCCAAGC
GATGGCGGAAGACCATGACCAGCGCCCTGCGCATGAAGCCGACCGACTCAGAGCTGTGGATCATGGCCGGCCGCC
GATCCGCGCATAACGGAGACATGGCGTCGGCGAGGAGCTTCTTCATGCGGGGGTGTCGGTTCTGCACAAAGGATT
GCGGGCTGTGGCTCGAGTATGCTCGGTGCGAGATGCAATGGCTGGCCAAAGTGGACAAACGCAAGGAGGCACCGA
AAACCGATGCGCTGCGGCCGGACAGAACCGATGATGGCGACGAGCTGAGTCTTTTGGGTAGCGACGACGACGACG
ACGACGACGAAGGAAATGAGGACGGAGAGGGAGGAAGCGGATTGCCCGTCGCATCAAACGCGCGGCCCAATGTCA
TCGACCAGCACTCCCGCCAAGTGCTCGAATCGAATCCCGCCATGGATGGTGCCATCCCCATGGCCATATTTGACA
TAGCACGGAAGCAAGTTTTCTTCACGCCAGACTTTGCAGAAACGTTTTTCATCATGATTTCCTCGTTTCGTAACG
TCTCTGTACAGCCCAAGATTTCCCAGCACGTCCTGGACACCATGGACACCATGTACCCGAACCACCCGTCTACTT
GCAGCTGCCACATCCGGCAACCCATACTGGGGTTGAGTCCTCACACGGCCGAGTTTCCCCGGAACTTGCGAGACG
TCCTGGTTCGCATGACAGAAAGGCTGGAAACGACGACGGACCGGCCAGCCCTGGTTCAGAAGACGATGGCGTGGA
TGGACGAATATCTCGCCTTGGACAATCTGGACAAGGGCATCAGGGCAGTTTTGGAACACATTAAAGGAAAAGTGG
CGGATTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail