Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5441
Gene name
Locationscaffold_444:11270..12407
Strand-
Gene length (bp)1137
Transcript length (bp)666
Coding sequence length (bp)663
Protein length (aa) 221

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion|Plastid 0.1715 0.124 0.5002 0.0682 0.6956 0.6715 0.3176 0.2846 0.3761 0.2233

SignalP

SignalP signal predicted Location Score
Yes 1 - 36 0.508915

Transmembrane Domains

Domain # Start End Length
1 157 179 22
2 189 211 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6312
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3627
Ophiocordyceps australis map64 (Brazil) OphauB2|128
Ophiocordyceps camponoti-rufipedis Ophun1|428
Ophiocordyceps kimflemingae Ophio5|5441 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9317

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5441
MRIDQSHNHPVQHRASRLVASFIFRVSIFSGIMSYAQVAASGPRQSSQEAAAPQPPEVVPNESASTSSLIDVDMP
SVQTVHSDFLDQDIKTTTQAERRDREAESSSLKKKASAGANSSSNNSSSSSSKASSGSMRSRADAWLTGHFADLS
DGSAGALAVANLAAVVGLSSYLGYRAWALYDRGALDWKAAGVGVGILAAVGAVESVVGGFLYRGKANKGSS
Coding >Ophio5|5441
ATGCGCATTGATCAGAGCCATAATCACCCCGTCCAGCATCGCGCCTCACGTCTCGTCGCTTCTTTCATCTTCCGA
GTGTCTATCTTCTCCGGCATCATGTCGTACGCCCAAGTCGCAGCCAGCGGGCCACGGCAATCCTCGCAAGAGGCG
GCCGCTCCTCAACCTCCGGAGGTGGTGCCCAACGAAAGCGCCTCGACATCGTCCCTCATCGACGTCGACATGCCC
AGCGTCCAGACCGTCCACTCCGACTTCCTCGACCAGGACATCAAGACGACGACGCAAGCCGAGCGACGCGACCGC
GAAGCCGAGTCGTCATCACTCAAGAAAAAGGCATCCGCCGGAGCTAACAGCAGCAGCAACAACAGCAGCAGCAGC
AGCAGCAAGGCCTCATCCGGCTCGATGCGCAGCAGGGCCGACGCCTGGCTGACCGGCCACTTCGCCGACTTATCC
GATGGCAGCGCCGGCGCCTTGGCCGTAGCCAACCTTGCTGCCGTCGTCGGCCTCAGCTCCTATCTCGGATACAGG
GCTTGGGCGCTGTATGATCGTGGCGCGCTGGATTGGAAGGCGGCTGGTGTCGGCGTCGGTATCTTGGCTGCCGTC
GGCGCTGTCGAGTCCGTCGTCGGTGGCTTTTTGTATAGGGGTAAGGCGAATAAGGGCTCGTCG
Transcript >Ophio5|5441
ATGCGCATTGATCAGAGCCATAATCACCCCGTCCAGCATCGCGCCTCACGTCTCGTCGCTTCTTTCATCTTCCGA
GTGTCTATCTTCTCCGGCATCATGTCGTACGCCCAAGTCGCAGCCAGCGGGCCACGGCAATCCTCGCAAGAGGCG
GCCGCTCCTCAACCTCCGGAGGTGGTGCCCAACGAAAGCGCCTCGACATCGTCCCTCATCGACGTCGACATGCCC
AGCGTCCAGACCGTCCACTCCGACTTCCTCGACCAGGACATCAAGACGACGACGCAAGCCGAGCGACGCGACCGC
GAAGCCGAGTCGTCATCACTCAAGAAAAAGGCATCCGCCGGAGCTAACAGCAGCAGCAACAACAGCAGCAGCAGC
AGCAGCAAGGCCTCATCCGGCTCGATGCGCAGCAGGGCCGACGCCTGGCTGACCGGCCACTTCGCCGACTTATCC
GATGGCAGCGCCGGCGCCTTGGCCGTAGCCAACCTTGCTGCCGTCGTCGGCCTCAGCTCCTATCTCGGATACAGG
GCTTGGGCGCTGTATGATCGTGGCGCGCTGGATTGGAAGGCGGCTGGTGTCGGCGTCGGTATCTTGGCTGCCGTC
GGCGCTGTCGAGTCCGTCGTCGGTGGCTTTTTGTATAGGGGTAAGGCGAATAAGGGCTCGTCGTAG
Gene >Ophio5|5441
ATGCGCATTGATCAGAGCCATAATCACCGTCAGAAGCCCTGCTAGCCCGTAGCAACAGCAGGTACCTAGGCAGTC
AGTGGTAGTAGAGGTGGGTGGTGGTAGTAGTAGTAGCGTAGCCCGTCAATATTGAGGTGGCCAATCCCGAGGCCA
TCAAATCCCACTCGGACGACGCTGTGGACTCAAGAAAGTACCGCCGTAACCCCCGCGCCTCCCAACTCATCGCCC
GCGTCCCCCCCCGGGGTTCCAAGTCACACTACAACCTCATCCTCCGAAGGTCTCCCCCCCGCCGGAAAAAAAAAA
AAAACAGCTGTCCGACAGCCGTCCAGCATCGCGCCTCACGTCTCGTCGCTTCTTTCATCTTCCGAGTGTCTATCT
TCTCCGGCATCAGTGAGTCTCTTTCTCGTCGGCGACGCGTCCAGCCACTAACGTCGGGTTTCGCAGTGTCGTACG
CCCAAGTCGCAGCCAGCGGGCCACGGCAATCCTCGCAAGAGGTGAGTTATCGAGCGGGGGCAAGGGGGGGAAAGG
GGGGAGACGAAGAAGGGAAGAATAAGAGAGAAAGAGAGAGAGAGAGAGAGAGAAGAACAGGCGGGGTTTCTAAAA
CTGAAATGATCAATCTAGGCGGCCGCTCCTCAACCTCCGGAGGTGGTGCCCAACGAAAGCGCCTCGACATCGTCC
CTCATCGACGTCGACATGCCCAGCGTCCAGACCGTCCACTCCGACTTCCTCGACCAGGACATCAAGACGACGACG
CAAGCCGAGCGACGCGACCGCGAAGCCGAGTCGTCATCACTCAAGAAAAAGGCATCCGCCGGAGCTAACAGCAGC
AGCAACAACAGCAGCAGCAGCAGCAGCAAGGCCTCATCCGGCTCGATGCGCAGCAGGGCCGACGCCTGGCTGACC
GGCCACTTCGCCGACTTATCCGATGGCAGCGCCGGCGCCTTGGCCGTAGCCAACCTTGCTGCCGTCGTCGGCCTC
AGCTCCTATCTCGGATACAGGGCTTGGGCGCTGTATGATCGTGGCGCGCTGGATTGGAAGGCGGCTGGTGTCGGC
GTCGGTATCTTGGCTGCCGTCGGCGCTGTCGAGTCCGTCGTCGGTGGCTTTTTGTATAGGGGTAAGGCGAATAAG
GGCTCGTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail