Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5435
Gene name
Locationscaffold_444:4434..5991
Strand-
Gene length (bp)1557
Transcript length (bp)1440
Coding sequence length (bp)1437
Protein length (aa) 479

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.2E-48 61 426
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 2.4E-09 75 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 11 447 5.0E-63
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 3 451 1.0E-62
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 13 478 5.0E-54
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 1 478 3.0E-50
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 7 469 1.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 11 447 5.0E-63
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 3 451 1.0E-62
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 13 478 5.0E-54
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 1 478 3.0E-50
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 7 469 1.0E-41
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 10 471 3.0E-41
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 52 237 7.0E-29
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 52 258 2.0E-28
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 11 471 8.0E-25
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 77 470 3.0E-24
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 17 473 2.0E-23
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 17 473 2.0E-23
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 29 470 5.0E-23
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 62 330 2.0E-22
sp|P32482|CMLA_PSEAI Chloramphenicol resistance protein OS=Pseudomonas aeruginosa GN=cmlA PE=3 SV=2 72 332 2.0E-22
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 50 471 3.0E-21
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 51 475 4.0E-21
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 11 479 8.0E-21
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 50 470 3.0E-20
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 63 455 6.0E-19
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 3 470 1.0E-18
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 72 421 1.0E-18
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 47 478 7.0E-18
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 77 443 9.0E-18
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 106 443 2.0E-17
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 60 470 5.0E-17
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 74 470 1.0E-16
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 67 312 1.0E-15
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 72 477 6.0E-15
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 72 470 6.0E-15
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 266 477 7.0E-15
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 72 470 7.0E-15
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 48 289 9.0E-15
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 116 471 3.0E-14
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 63 426 1.0E-13
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 9 323 5.0E-11
sp|A8ACM0|MDTL_CITK8 Multidrug resistance protein MdtL OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtL PE=3 SV=1 72 292 1.0E-10
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 60 301 2.0E-10
sp|Q8FBV0|MDTL_ECOL6 Multidrug resistance protein MdtL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtL PE=3 SV=1 72 292 2.0E-10
sp|B7N2F5|MDTL_ECO81 Multidrug resistance protein MdtL OS=Escherichia coli O81 (strain ED1a) GN=mdtL PE=3 SV=1 72 292 2.0E-10
sp|Q0SYP9|MDTL_SHIF8 Multidrug resistance protein MdtL OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtL PE=3 SV=1 72 292 6.0E-10
sp|B7UMH7|MDTL_ECO27 Multidrug resistance protein MdtL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtL PE=3 SV=1 72 292 6.0E-10
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 2 462 6.0E-10
sp|O51798|MMLH_CUPPJ Probable 4-methylmuconolactone transporter OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=mmlH PE=3 SV=1 36 311 7.0E-10
sp|B7NF27|MDTL_ECOLU Multidrug resistance protein MdtL OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtL PE=3 SV=1 72 292 7.0E-10
sp|Q0TAZ8|MDTL_ECOL5 Multidrug resistance protein MdtL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtL PE=3 SV=1 72 292 7.0E-10
sp|B7M562|MDTL_ECO8A Multidrug resistance protein MdtL OS=Escherichia coli O8 (strain IAI1) GN=mdtL PE=3 SV=1 72 292 7.0E-10
sp|A7ZTR5|MDTL_ECO24 Multidrug resistance protein MdtL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtL PE=3 SV=1 72 292 7.0E-10
sp|Q83PL6|MDTL_SHIFL Multidrug resistance protein MdtL OS=Shigella flexneri GN=mdtL PE=3 SV=1 72 292 8.0E-10
sp|Q3YWK3|MDTL_SHISS Multidrug resistance protein MdtL OS=Shigella sonnei (strain Ss046) GN=mdtL PE=3 SV=1 72 292 8.0E-10
sp|Q31UW4|MDTL_SHIBS Multidrug resistance protein MdtL OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtL PE=3 SV=1 72 292 8.0E-10
sp|B2TUR5|MDTL_SHIB3 Multidrug resistance protein MdtL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtL PE=3 SV=1 72 292 8.0E-10
sp|B1IX28|MDTL_ECOLC Multidrug resistance protein MdtL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtL PE=3 SV=1 72 292 8.0E-10
sp|A8A6H2|MDTL_ECOHS Multidrug resistance protein MdtL OS=Escherichia coli O9:H4 (strain HS) GN=mdtL PE=3 SV=1 72 292 8.0E-10
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 266 451 9.0E-10
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 95 472 9.0E-10
sp|B1LL36|MDTL_ECOSM Multidrug resistance protein MdtL OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtL PE=3 SV=1 72 292 1.0E-09
sp|B6I3U3|MDTL_ECOSE Multidrug resistance protein MdtL OS=Escherichia coli (strain SE11) GN=mdtL PE=3 SV=1 72 292 1.0E-09
sp|P31462|MDTL_ECOLI Multidrug resistance protein MdtL OS=Escherichia coli (strain K12) GN=mdtL PE=1 SV=2 72 292 1.0E-09
sp|B1X9T9|MDTL_ECODH Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / DH10B) GN=mdtL PE=3 SV=1 72 292 1.0E-09
sp|C4ZYY8|MDTL_ECOBW Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtL PE=3 SV=1 72 292 1.0E-09
sp|B7L855|MDTL_ECO55 Multidrug resistance protein MdtL OS=Escherichia coli (strain 55989 / EAEC) GN=mdtL PE=3 SV=1 72 292 1.0E-09
sp|Q1R4M4|MDTL_ECOUT Multidrug resistance protein MdtL OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtL PE=3 SV=1 72 292 1.0E-09
sp|A1AHP3|MDTL_ECOK1 Multidrug resistance protein MdtL OS=Escherichia coli O1:K1 / APEC GN=mdtL PE=3 SV=1 72 292 1.0E-09
sp|B7MGD1|MDTL_ECO45 Multidrug resistance protein MdtL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtL PE=3 SV=1 72 292 1.0E-09
sp|B7LK52|MDTL_ESCF3 Multidrug resistance protein MdtL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtL PE=3 SV=1 72 292 1.0E-09
sp|B7NR12|MDTL_ECO7I Multidrug resistance protein MdtL OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtL PE=3 SV=1 72 292 2.0E-09
sp|Q328Z8|MDTL_SHIDS Multidrug resistance protein MdtL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mdtL PE=3 SV=1 72 234 2.0E-09
sp|P31442|EMRD_ECOLI Multidrug resistance protein D OS=Escherichia coli (strain K12) GN=emrD PE=1 SV=2 72 242 2.0E-09
sp|B5XZP2|MDTL_KLEP3 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae (strain 342) GN=mdtL PE=3 SV=1 72 292 2.0E-09
sp|Q1RI77|BCRH_RICBR Uncharacterized transporter RBE_0856 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0856 PE=3 SV=1 66 287 4.0E-09
sp|B5YXB4|MDTL_ECO5E Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtL PE=3 SV=1 72 234 7.0E-09
sp|Q8XB24|MDTL_ECO57 Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 GN=mdtL PE=3 SV=1 72 234 7.0E-09
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 168 472 9.0E-09
sp|B5QUQ6|MDTL_SALEP Multidrug resistance protein MdtL OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtL PE=3 SV=1 72 292 9.0E-09
sp|B5FN15|MDTL_SALDC Multidrug resistance protein MdtL OS=Salmonella dublin (strain CT_02021853) GN=mdtL PE=3 SV=1 72 292 9.0E-09
sp|B4TAV4|MDTL_SALHS Multidrug resistance protein MdtL OS=Salmonella heidelberg (strain SL476) GN=mdtL PE=3 SV=1 72 292 1.0E-08
sp|C0Q2L5|MDTL_SALPC Multidrug resistance protein MdtL OS=Salmonella paratyphi C (strain RKS4594) GN=mdtL PE=3 SV=1 72 292 1.0E-08
sp|Q57HZ5|MDTL_SALCH Multidrug resistance protein MdtL OS=Salmonella choleraesuis (strain SC-B67) GN=mdtL PE=3 SV=1 72 292 1.0E-08
sp|Q8ZKY1|MDTL_SALTY Multidrug resistance protein MdtL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtL PE=3 SV=1 72 292 2.0E-08
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 117 260 2.0E-08
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 62 212 2.0E-08
sp|A9MJT5|MDTL_SALAR Multidrug resistance protein MdtL OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mdtL PE=3 SV=1 72 292 2.0E-08
sp|B5BIM0|MDTL_SALPK Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtL PE=3 SV=1 72 292 2.0E-08
sp|Q5PKV6|MDTL_SALPA Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtL PE=3 SV=1 72 292 2.0E-08
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 48 211 3.0E-08
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 48 211 3.0E-08
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 102 444 4.0E-08
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 52 215 4.0E-08
sp|A9MX86|MDTL_SALPB Multidrug resistance protein MdtL OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtL PE=3 SV=1 72 292 4.0E-08
sp|B4SYB3|MDTL_SALNS Multidrug resistance protein MdtL OS=Salmonella newport (strain SL254) GN=mdtL PE=3 SV=1 72 292 4.0E-08
sp|B5EYX7|MDTL_SALA4 Multidrug resistance protein MdtL OS=Salmonella agona (strain SL483) GN=mdtL PE=3 SV=1 72 292 4.0E-08
sp|B4TN12|MDTL_SALSV Multidrug resistance protein MdtL OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtL PE=3 SV=1 72 292 5.0E-08
sp|Q4UMJ9|BCRH_RICFE Uncharacterized transporter RF_0358 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0358 PE=3 SV=1 66 324 5.0E-08
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 48 243 6.0E-08
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 7 475 7.0E-08
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 48 211 7.0E-08
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 48 211 8.0E-08
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 48 211 8.0E-08
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 48 211 8.0E-08
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 48 211 9.0E-08
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 48 211 9.0E-08
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 48 211 1.0E-07
sp|A0L190|MDTL_SHESA Multidrug resistance protein MdtL OS=Shewanella sp. (strain ANA-3) GN=mdtL PE=3 SV=1 72 292 1.0E-07
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 63 297 2.0E-07
sp|Q8Z2N9|MDTL_SALTI Multidrug resistance protein MdtL OS=Salmonella typhi GN=mdtL PE=3 SV=1 72 292 2.0E-07
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 48 211 2.0E-07
sp|A6TG19|MDTL_KLEP7 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtL PE=3 SV=1 72 292 3.0E-07
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 76 217 3.0E-07
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 76 225 4.0E-07
sp|P77726|YAJR_ECOLI Inner membrane transport protein YajR OS=Escherichia coli (strain K12) GN=yajR PE=1 SV=2 74 239 9.0E-07
sp|Q87FV4|MDTL_VIBPA Multidrug resistance protein MdtL OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mdtL PE=3 SV=1 72 292 3.0E-06
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 50 211 3.0E-06
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 50 211 5.0E-06
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 63 283 6.0E-06
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 63 283 6.0E-06
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 63 283 6.0E-06
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 50 211 6.0E-06
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 63 283 6.0E-06
sp|O24723|PHDT_NOCSK Probable 1-hydroxy-2-naphthoate transporter OS=Nocardioides sp. (strain KP7) PE=3 SV=1 80 260 7.0E-06
sp|P36890|TCR_STAHY Tetracycline resistance protein OS=Staphylococcus hyicus GN=tet PE=3 SV=1 63 207 8.0E-06
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 72 473 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 54 76 22
2 91 113 22
3 120 142 22
4 152 174 22
5 179 201 22
6 211 230 19
7 260 282 22
8 297 319 22
9 352 371 19
10 376 398 22
11 419 436 17
12 441 463 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5435
MRSTMTEVRQKDEKEGDRSSSARPSDSGEAEGQPLAPLQTGPPYSVFTTWQKRAIALGAAGAAFFSPLTAMVFLP
ALTAIARDLGVTIPEINLTITTYMVFQGITPMFIGSLADSGGRRPAYVACFIIYIGANVGLALVPSYGALMALRC
LQSAGSSSTIALCTAVVADVVTSAERGQYVGFTLVPAVLAPALGPVIGGLLSQFLGWRSIFWFLVISSGVTVVLI
ILFFPETCRHINRQRRRETRLVDTKSERKPIQETAVLLWTSSLVFAGFYCVASAIPVLFSDRYGFDQIKVGLMYL
PVAVGSIGAACIVGPLINWNFRRHCAKLGVACDGKRQQDLSEFPIERARLEIGFPLLAVAGASIIGWGWAIQARA
HVAVPCIISVGLGIGIIGFNNTSNVLLVDMYPGKAGTATAANNLTRCLVGAGASAAIVPMINAMGVGWAFTLAGG
MLVLCLPAILLIVSCGQKWRNERALTRRG
Coding >Ophio5|5435
ATGAGAAGTACCATGACGGAGGTGCGTCAAAAGGATGAAAAAGAAGGCGATCGTTCATCATCAGCCCGTCCGAGC
GACAGCGGAGAAGCCGAGGGCCAGCCTCTGGCGCCGCTACAGACCGGACCGCCTTATTCCGTCTTTACGACATGG
CAGAAACGCGCCATAGCCCTTGGAGCCGCCGGAGCAGCCTTTTTTTCGCCCCTGACGGCCATGGTGTTTCTGCCG
GCCCTGACAGCCATTGCCCGCGATCTAGGCGTCACCATTCCGGAAATCAACCTCACCATCACGACCTACATGGTC
TTCCAGGGCATCACGCCCATGTTCATTGGCTCGCTGGCAGATAGTGGTGGTAGGCGACCGGCGTATGTCGCCTGC
TTCATCATCTACATTGGTGCCAATGTCGGTCTCGCCCTGGTTCCCAGCTATGGTGCTCTCATGGCCCTACGCTGT
TTGCAGTCTGCTGGGTCGAGCAGCACCATCGCCTTATGTACGGCCGTCGTGGCCGACGTTGTCACCTCGGCCGAG
CGAGGGCAATATGTGGGCTTCACTCTCGTTCCCGCCGTCCTCGCCCCTGCTCTGGGCCCCGTCATCGGCGGTCTT
CTCTCTCAGTTCCTCGGATGGAGGTCTATATTCTGGTTCCTGGTCATATCTTCCGGGGTGACCGTCGTTTTGATC
ATACTCTTCTTTCCGGAAACTTGCAGACATATTAACCGCCAGCGCCGACGCGAGACGCGACTCGTTGACACCAAA
TCAGAAAGAAAGCCAATTCAAGAGACGGCCGTCCTCCTCTGGACCAGCAGCCTGGTTTTTGCAGGCTTCTACTGC
GTCGCCTCCGCCATTCCAGTGCTCTTCAGCGACCGATACGGTTTCGACCAGATCAAAGTCGGCCTGATGTATCTG
CCCGTGGCTGTGGGCTCCATCGGCGCCGCCTGCATCGTCGGCCCCCTGATCAACTGGAACTTTCGGCGACATTGC
GCCAAACTAGGCGTGGCGTGCGACGGCAAGCGGCAACAGGACCTCTCCGAGTTTCCCATCGAGCGGGCCCGCCTG
GAAATTGGATTTCCGTTGCTGGCCGTGGCCGGAGCGAGCATCATCGGCTGGGGCTGGGCGATACAAGCAAGGGCT
CACGTGGCGGTGCCGTGCATCATCAGCGTCGGCTTGGGCATTGGCATCATCGGCTTCAACAACACGAGCAACGTG
CTGCTCGTGGACATGTACCCGGGCAAGGCCGGGACGGCGACGGCGGCCAACAATCTGACTCGTTGTCTGGTCGGC
GCGGGGGCAAGCGCCGCCATCGTTCCCATGATCAACGCCATGGGTGTGGGTTGGGCGTTTACCCTTGCAGGGGGG
ATGCTTGTCTTGTGCTTGCCTGCCATACTGCTCATTGTCTCGTGCGGGCAGAAGTGGCGAAACGAGCGGGCTTTG
ACGAGACGCGGG
Transcript >Ophio5|5435
ATGAGAAGTACCATGACGGAGGTGCGTCAAAAGGATGAAAAAGAAGGCGATCGTTCATCATCAGCCCGTCCGAGC
GACAGCGGAGAAGCCGAGGGCCAGCCTCTGGCGCCGCTACAGACCGGACCGCCTTATTCCGTCTTTACGACATGG
CAGAAACGCGCCATAGCCCTTGGAGCCGCCGGAGCAGCCTTTTTTTCGCCCCTGACGGCCATGGTGTTTCTGCCG
GCCCTGACAGCCATTGCCCGCGATCTAGGCGTCACCATTCCGGAAATCAACCTCACCATCACGACCTACATGGTC
TTCCAGGGCATCACGCCCATGTTCATTGGCTCGCTGGCAGATAGTGGTGGTAGGCGACCGGCGTATGTCGCCTGC
TTCATCATCTACATTGGTGCCAATGTCGGTCTCGCCCTGGTTCCCAGCTATGGTGCTCTCATGGCCCTACGCTGT
TTGCAGTCTGCTGGGTCGAGCAGCACCATCGCCTTATGTACGGCCGTCGTGGCCGACGTTGTCACCTCGGCCGAG
CGAGGGCAATATGTGGGCTTCACTCTCGTTCCCGCCGTCCTCGCCCCTGCTCTGGGCCCCGTCATCGGCGGTCTT
CTCTCTCAGTTCCTCGGATGGAGGTCTATATTCTGGTTCCTGGTCATATCTTCCGGGGTGACCGTCGTTTTGATC
ATACTCTTCTTTCCGGAAACTTGCAGACATATTAACCGCCAGCGCCGACGCGAGACGCGACTCGTTGACACCAAA
TCAGAAAGAAAGCCAATTCAAGAGACGGCCGTCCTCCTCTGGACCAGCAGCCTGGTTTTTGCAGGCTTCTACTGC
GTCGCCTCCGCCATTCCAGTGCTCTTCAGCGACCGATACGGTTTCGACCAGATCAAAGTCGGCCTGATGTATCTG
CCCGTGGCTGTGGGCTCCATCGGCGCCGCCTGCATCGTCGGCCCCCTGATCAACTGGAACTTTCGGCGACATTGC
GCCAAACTAGGCGTGGCGTGCGACGGCAAGCGGCAACAGGACCTCTCCGAGTTTCCCATCGAGCGGGCCCGCCTG
GAAATTGGATTTCCGTTGCTGGCCGTGGCCGGAGCGAGCATCATCGGCTGGGGCTGGGCGATACAAGCAAGGGCT
CACGTGGCGGTGCCGTGCATCATCAGCGTCGGCTTGGGCATTGGCATCATCGGCTTCAACAACACGAGCAACGTG
CTGCTCGTGGACATGTACCCGGGCAAGGCCGGGACGGCGACGGCGGCCAACAATCTGACTCGTTGTCTGGTCGGC
GCGGGGGCAAGCGCCGCCATCGTTCCCATGATCAACGCCATGGGTGTGGGTTGGGCGTTTACCCTTGCAGGGGGG
ATGCTTGTCTTGTGCTTGCCTGCCATACTGCTCATTGTCTCGTGCGGGCAGAAGTGGCGAAACGAGCGGGCTTTG
ACGAGACGCGGGTAA
Gene >Ophio5|5435
ATGAGAAGTACCATGACGGAGGTGCGTCAAAAGGATGAAAAAGAAGGCGATCGTTCATCATCAGCCCGTCCGAGC
GACAGCGGAGAAGCCGAGGGCCAGCCTCTGGCGCCGCTACAGACCGGACCGCCTTATTCCGTCTTTACGACATGG
CAGAAACGCGCCATAGCCCTTGGAGCCGCCGGAGCAGCCTTTTTTTCGCCCCTGACGGCCATGGTGTTTCTGCCG
GCCCTGACAGCCATTGCCCGCGATCTAGGCGTCACCATTCCGGAAATCAACCTCACCATCACGACCTACATGGTC
TTCCAGGGCATCACGCCCATGTTCATTGGCTCGCTGGCAGATAGTGGTGGTAGGCGACCGGCGTATGTCGCCTGC
TTCATCATCTACATTGGTGCCAATGTCGGTCTCGCCCTGGTTCCCAGCTATGGTGCTCTCATGGCCCTACGCTGT
TTGCAGTCTGCTGGGTCGAGCAGCACCATCGCCTTATGTACGGCCGTCGTGGCCGACGTTGTCACCTCGGCCGAG
CGAGGGCAATATGTGGGCTTCACTCTCGTTCCCGCCGTCCTCGCCCCTGCTCTGGGCCCCGTCATCGGCGGTCTT
CTCTCTCAGTTCCTCGGATGGAGGTCTATATTCTGGTTCCTGGTCATATCTTCCGGGGTGACCGTCGTTTTGATC
ATACTCTTCTTTCCGGAAACTTGCAGACATATTGTGGGCGACGGATCACTCCTGCCACCGCCCATGTATCGTACC
GTTTGGCAAGCACTGAGACGACGCAGAACCGCCAGCGCCGACGCGAGACGCGACTCGTTGACACCAAATCAGAAA
GAAAGCCAATTCAAGTTCAGAGTGCCGAACATCTTGGGTTCTCTGTTTATGCTCTTTGAAAAGGAGACGGCCGTC
CTCCTCTGGACCAGCAGCCTGGTTTTTGCAGGCTTCTACTGCGTCGCCTCCGCCATTCCAGTGCTCTTCAGCGAC
CGATACGGTTTCGACCAGATCAAAGTCGGCCTGATGTATCTGCCCGTGGCTGTGGGCTCCATCGGCGCCGCCTGC
ATCGTCGGCCCCCTGATCAACTGGAACTTTCGGCGACATTGCGCCAAACTAGGCGTGGCGTGCGACGGCAAGCGG
CAACAGGACCTCTCCGAGTTTCCCATCGAGCGGGCCCGCCTGGAAATTGGATTTCCGTTGCTGGCCGTGGCCGGA
GCGAGCATCATCGGCTGGGGCTGGGCGATACAAGCAAGGGCTCACGTGGCGGTGCCGTGCATCATCAGCGTCGGC
TTGGGCATTGGCATCATCGGCTTCAACAACACGAGCAACGTGCTGCTCGTGGACATGTACCCGGGCAAGGCCGGG
ACGGCGACGGCGGCCAACAATCTGACTCGTTGTCTGGTCGGCGCGGGGGCAAGCGCCGCCATCGTTCCCATGATC
AACGCCATGGGTGTGGGTTGGGCGTTTACCCTTGCAGGGGGGATGCTTGTCTTGTGCTTGCCTGCCATACTGCTC
ATTGTCTCGTGCGGGCAGAAGTGGCGAAACGAGCGGGCTTTGACGAGACGCGGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail