Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5418
Gene name
Locationscaffold_442:2837..4925
Strand+
Gene length (bp)2088
Transcript length (bp)1980
Coding sequence length (bp)1977
Protein length (aa) 659

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00474 SSF Sodium:solute symporter family 2.5E-21 48 465

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94469|DUR31_SCHPO Probable urea active transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-1 PE=3 SV=1 6 649 0.0E+00
sp|P33413|DUR3_YEAST Urea active transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR3 PE=1 SV=2 1 637 0.0E+00
sp|F4KD71|DUR3_ARATH Urea-proton symporter DUR3 OS=Arabidopsis thaliana GN=DUR3 PE=1 SV=1 8 649 1.0E-161
sp|Q7XBS0|DUR3_ORYSJ Urea-proton symporter DUR3 OS=Oryza sativa subsp. japonica GN=DUR3 PE=1 SV=1 6 638 5.0E-154
sp|Q9URY6|DUR33_SCHPO Probable urea active transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-3 PE=3 SV=1 8 656 3.0E-147
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94469|DUR31_SCHPO Probable urea active transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-1 PE=3 SV=1 6 649 0.0E+00
sp|P33413|DUR3_YEAST Urea active transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR3 PE=1 SV=2 1 637 0.0E+00
sp|F4KD71|DUR3_ARATH Urea-proton symporter DUR3 OS=Arabidopsis thaliana GN=DUR3 PE=1 SV=1 8 649 1.0E-161
sp|Q7XBS0|DUR3_ORYSJ Urea-proton symporter DUR3 OS=Oryza sativa subsp. japonica GN=DUR3 PE=1 SV=1 6 638 5.0E-154
sp|Q9URY6|DUR33_SCHPO Probable urea active transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-3 PE=3 SV=1 8 656 3.0E-147
sp|Q8TFG0|DUR32_SCHPO Probable urea active transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-2 PE=3 SV=1 6 654 4.0E-126
sp|P96169|SGLT_VIBPH Sodium/glucose cotransporter OS=Vibrio parahaemolyticus GN=sglT PE=1 SV=2 43 460 1.0E-07
sp|A7MBD8|SC5AC_BOVIN Sodium-coupled monocarboxylate transporter 2 OS=Bos taurus GN=SLC5A12 PE=2 SV=1 44 208 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 55 73 18
3 88 110 22
4 131 153 22
5 168 190 22
6 195 214 19
7 255 277 22
8 290 312 22
9 342 364 22
10 402 424 22
11 429 451 22
12 458 477 19
13 497 519 22
14 565 587 22
15 602 624 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5418
MASPGPALSQGYGYGIILGLGFAFALLMISITHLLKRFNNEVQTSEMFNTAGRSVKSGLVAAAVVSSWTWAATLL
QSSGVCYRYGVSGPFWYASGATVQILLFATLAIALKKRAPNCHTFLEAVHARYGRPAHLTFVAFGLATNVLVSLM
LIAGGAATINALTGVDAVAAIFLMPVPVVAYTLIGGLKATFITDYIHGFAVIVIVVIFALETYARSDILGSPSAV
YDGLVAAASAHPVPGNRDGSFLTMRSRGGVTFFVINIVGNFGTVFLDNGYYNKAIAAHPVHALPGYLIGGAAWFA
IPWLTATTLGLAALALESSPRFPTYPARMSEADVSAGLVLPYAAVALLGKGGAVMTLIMVFLAVTSSFNAELVAT
SSIFTYDVYRTYARPDAGGGRLKRTSHVCMVLYTAAICLASVGLWYNGISMGYLYLLMGVLISSGVIPAVFTLLW
GRQNRWAATLAPILGTVLAVAAWLVTARRTCGRLDVECTGSNDAMLVGNLVALLSPLVLVPALCVAFGFDNYDWA
SMAAIRRANDDDVLGGSNLRAMARTHDAEASTERRKLDRAFKLASVVTVSMALSLLVLWPMPMYGSGYIFSRSFF
TGWVAVGIAWIFGSLVAVGLYPLWESRVTLWRIVRSMLRGKRAAAVVKDGETDEVKGRG
Coding >Ophio5|5418
ATGGCATCCCCCGGTCCCGCACTGAGCCAAGGCTACGGCTACGGCATCATCCTCGGCCTCGGCTTCGCCTTTGCC
CTGTTAATGATCTCCATCACCCACCTACTCAAGCGCTTCAACAACGAGGTGCAGACATCCGAAATGTTCAACACG
GCCGGCCGCAGCGTGAAATCAGGCCTCGTCGCTGCCGCCGTCGTCTCCTCCTGGACCTGGGCCGCCACGCTCCTA
CAGAGTTCGGGCGTGTGTTATCGTTACGGCGTCTCGGGCCCCTTTTGGTACGCGTCTGGCGCGACGGTTCAGATT
CTACTTTTCGCCACGCTTGCTATCGCGCTCAAGAAGCGGGCGCCAAATTGTCATACTTTTCTCGAGGCTGTTCAT
GCTCGTTATGGAAGGCCGGCCCATTTGACATTTGTCGCCTTTGGACTTGCTACCAATGTGCTCGTGTCGCTGATG
TTGATTGCCGGCGGTGCGGCGACCATCAACGCCTTGACGGGTGTCGATGCTGTGGCTGCCATATTCCTTATGCCT
GTTCCCGTCGTGGCTTACACGCTCATCGGTGGGCTCAAGGCCACCTTCATAACCGACTACATTCATGGCTTCGCC
GTCATCGTCATCGTCGTCATCTTCGCTCTCGAGACGTACGCCAGATCAGACATCCTCGGCAGCCCGTCTGCCGTC
TATGATGGTCTCGTCGCCGCTGCATCAGCCCATCCCGTACCCGGCAACCGGGACGGAAGTTTCCTCACGATGCGT
TCGCGCGGCGGCGTAACCTTTTTCGTCATCAACATTGTCGGCAACTTTGGTACCGTCTTCCTCGATAACGGTTAC
TACAACAAGGCCATTGCCGCCCATCCGGTTCATGCTCTGCCGGGCTATCTTATCGGTGGCGCTGCCTGGTTCGCG
ATTCCCTGGCTGACGGCTACCACGTTGGGCTTGGCTGCTCTCGCGCTCGAGTCCAGCCCGCGCTTCCCGACGTAC
CCGGCTCGCATGAGTGAAGCAGACGTTTCGGCTGGTCTGGTGCTTCCGTACGCTGCTGTCGCTCTGTTGGGGAAG
GGTGGTGCCGTCATGACGCTCATCATGGTCTTTCTCGCCGTTACTTCGTCCTTCAACGCAGAGCTGGTGGCTACC
TCGTCCATCTTTACCTATGACGTCTACCGCACCTACGCGAGGCCCGATGCCGGCGGAGGGCGACTCAAACGCACT
TCACACGTCTGCATGGTGCTGTACACGGCTGCCATCTGTCTCGCCTCCGTCGGACTCTGGTACAACGGCATCTCT
ATGGGTTATCTGTACCTGCTCATGGGCGTCCTCATCTCGTCCGGAGTTATCCCCGCCGTATTCACCCTGTTATGG
GGTCGGCAGAACCGTTGGGCGGCGACTCTGGCCCCCATCCTTGGCACTGTCCTTGCCGTTGCCGCCTGGCTTGTC
ACTGCCCGGAGGACATGTGGCCGGCTGGATGTCGAGTGCACGGGATCCAACGACGCCATGCTCGTCGGTAACCTC
GTCGCCCTCTTGTCACCTCTGGTCCTGGTGCCGGCGCTGTGCGTAGCCTTTGGCTTCGATAATTACGACTGGGCC
TCCATGGCAGCCATCCGCAGGGCCAACGACGACGACGTCCTTGGCGGCTCTAACCTACGTGCGATGGCGAGGACG
CACGACGCCGAAGCCTCCACGGAGCGACGCAAACTCGACCGGGCTTTTAAGCTGGCCAGCGTCGTCACCGTCAGC
ATGGCATTGTCCTTACTGGTGCTCTGGCCGATGCCCATGTACGGCTCTGGCTACATCTTCTCTCGAAGCTTCTTC
ACCGGGTGGGTGGCGGTCGGTATTGCGTGGATCTTTGGCTCATTGGTCGCCGTAGGTCTGTATCCGTTGTGGGAG
AGCCGGGTGACGCTTTGGCGAATCGTTAGATCGATGCTAAGGGGCAAGCGGGCGGCGGCAGTCGTCAAGGATGGG
GAAACGGACGAAGTCAAAGGCCGTGGC
Transcript >Ophio5|5418
ATGGCATCCCCCGGTCCCGCACTGAGCCAAGGCTACGGCTACGGCATCATCCTCGGCCTCGGCTTCGCCTTTGCC
CTGTTAATGATCTCCATCACCCACCTACTCAAGCGCTTCAACAACGAGGTGCAGACATCCGAAATGTTCAACACG
GCCGGCCGCAGCGTGAAATCAGGCCTCGTCGCTGCCGCCGTCGTCTCCTCCTGGACCTGGGCCGCCACGCTCCTA
CAGAGTTCGGGCGTGTGTTATCGTTACGGCGTCTCGGGCCCCTTTTGGTACGCGTCTGGCGCGACGGTTCAGATT
CTACTTTTCGCCACGCTTGCTATCGCGCTCAAGAAGCGGGCGCCAAATTGTCATACTTTTCTCGAGGCTGTTCAT
GCTCGTTATGGAAGGCCGGCCCATTTGACATTTGTCGCCTTTGGACTTGCTACCAATGTGCTCGTGTCGCTGATG
TTGATTGCCGGCGGTGCGGCGACCATCAACGCCTTGACGGGTGTCGATGCTGTGGCTGCCATATTCCTTATGCCT
GTTCCCGTCGTGGCTTACACGCTCATCGGTGGGCTCAAGGCCACCTTCATAACCGACTACATTCATGGCTTCGCC
GTCATCGTCATCGTCGTCATCTTCGCTCTCGAGACGTACGCCAGATCAGACATCCTCGGCAGCCCGTCTGCCGTC
TATGATGGTCTCGTCGCCGCTGCATCAGCCCATCCCGTACCCGGCAACCGGGACGGAAGTTTCCTCACGATGCGT
TCGCGCGGCGGCGTAACCTTTTTCGTCATCAACATTGTCGGCAACTTTGGTACCGTCTTCCTCGATAACGGTTAC
TACAACAAGGCCATTGCCGCCCATCCGGTTCATGCTCTGCCGGGCTATCTTATCGGTGGCGCTGCCTGGTTCGCG
ATTCCCTGGCTGACGGCTACCACGTTGGGCTTGGCTGCTCTCGCGCTCGAGTCCAGCCCGCGCTTCCCGACGTAC
CCGGCTCGCATGAGTGAAGCAGACGTTTCGGCTGGTCTGGTGCTTCCGTACGCTGCTGTCGCTCTGTTGGGGAAG
GGTGGTGCCGTCATGACGCTCATCATGGTCTTTCTCGCCGTTACTTCGTCCTTCAACGCAGAGCTGGTGGCTACC
TCGTCCATCTTTACCTATGACGTCTACCGCACCTACGCGAGGCCCGATGCCGGCGGAGGGCGACTCAAACGCACT
TCACACGTCTGCATGGTGCTGTACACGGCTGCCATCTGTCTCGCCTCCGTCGGACTCTGGTACAACGGCATCTCT
ATGGGTTATCTGTACCTGCTCATGGGCGTCCTCATCTCGTCCGGAGTTATCCCCGCCGTATTCACCCTGTTATGG
GGTCGGCAGAACCGTTGGGCGGCGACTCTGGCCCCCATCCTTGGCACTGTCCTTGCCGTTGCCGCCTGGCTTGTC
ACTGCCCGGAGGACATGTGGCCGGCTGGATGTCGAGTGCACGGGATCCAACGACGCCATGCTCGTCGGTAACCTC
GTCGCCCTCTTGTCACCTCTGGTCCTGGTGCCGGCGCTGTGCGTAGCCTTTGGCTTCGATAATTACGACTGGGCC
TCCATGGCAGCCATCCGCAGGGCCAACGACGACGACGTCCTTGGCGGCTCTAACCTACGTGCGATGGCGAGGACG
CACGACGCCGAAGCCTCCACGGAGCGACGCAAACTCGACCGGGCTTTTAAGCTGGCCAGCGTCGTCACCGTCAGC
ATGGCATTGTCCTTACTGGTGCTCTGGCCGATGCCCATGTACGGCTCTGGCTACATCTTCTCTCGAAGCTTCTTC
ACCGGGTGGGTGGCGGTCGGTATTGCGTGGATCTTTGGCTCATTGGTCGCCGTAGGTCTGTATCCGTTGTGGGAG
AGCCGGGTGACGCTTTGGCGAATCGTTAGATCGATGCTAAGGGGCAAGCGGGCGGCGGCAGTCGTCAAGGATGGG
GAAACGGACGAAGTCAAAGGCCGTGGCTGA
Gene >Ophio5|5418
ATGGCATCCCCCGGTCCCGCACTGAGCCAAGGCTACGGCTACGGCATCATCCTCGGCCTCGGCTTCGCCTTTGCC
CTGTTAATGGTTGTGTCGATCCGTCATGCTCCTCAGCGTCCATGCCCTCGTTCTCTAACCTTGACAGATCTCCAT
CACCCACCTACTCAAGCGCTTCAACAACGAGGTGCAGACATCCGAAATGTTCAACACGGCCGGCCGCAGCGTGAA
ATCAGGCCTCGTCGCTGCCGCCGTCGTCTCCTCCTGGACCTGGGCCGCCACGCTCCTACAGAGTTCGGGCGTGTG
TTATCGTTACGGCGTCTCGGGCCCCTTTTGGTACGCGTCTGGCGCGACGGTTCAGATTCTACTTTTCGCCACGCT
TGCTATCGCGCTCAAGAAGCGGGCGCCAAATTGTCATACTTTTCTCGAGGCTGTTCATGCTCGTTATGGAAGGCC
GGCCCATTTGACATTTGTCGCCTTTGGACTTGCTACCAATGTGCTCGTGTCGCTGATGTTGATTGCCGGCGGTGC
GGCGACCATCAACGCCTTGACGGGTGTCGATGCTGTGGCTGCCATATTCCTTATGCCTGTTCCCGTCGTGGCTTA
CACGCTCATCGGTGGGCTCAAGGCCACCTTCATAACCGACTACATTCATGGCTTCGCCGTCATCGTCATCGTCGT
CATCTTCGCTCTCGAGACGTACGCCAGATCAGACATCCTCGGCAGCCCGTCTGCCGTCTATGATGGTCTCGTCGC
CGCTGCATCAGCCCATCCCGTACCCGGCAACCGGGACGGAAGTTTCCTCACGATGCGTTCGCGCGGCGGCGTAAC
CTTTTTCGTCATCAACATTGTCGGCAACTTTGGTACCGTCTTCCTCGATAACGGTTACTACAACAAGGCCATTGC
CGCCCATCCGGTTCATGCTCTGCCGGGCTATCTTATCGGTGGCGCTGCCTGGTTCGCGATTCCCTGGCTGACGGC
TACCACGTTGGGCTTGGCTGCTCTCGCGCTCGAGTCCAGCCCGCGCTTCCCGACGTACCCGGCTCGCATGAGTGA
AGCAGACGTTTCGGCTGGTCTGGTGCTTCCGTACGCTGCTGTCGCTCTGTTGGGGAAGGGTGGTGCCGTCATGAC
GCTCATCATGGTCTTTCTCGCCGTTACTTCGTCCTTCAACGCAGAGCTGGTGGCTACCTCGTCCATCTTTACCTA
TGACGTCTACCGCACCTACGCGAGGCCCGATGCCGGCGGAGGGCGACTCAAACGCACTTCACACGTCTGCATGGT
GCTGTACACGGCTGCCATCTGTCTCGCCTCCGTCGGACTCTGGTACAACGGCATCTCTATGGGTTATCTGTACCT
GCTCATGGGCGTCCTCATCTCGTCCGGAGTTATCCCCGCCGTATTCACCCTGTTATGGGGTCGGCAGAACCGTTG
GGCGGCGACTCTGGCCCCCATCCTTGGCACTGTCCTTGCCGTTGCCGCCTGGCTTGTCACTGCCCGGAGGACATG
TGGCCGGCTGGATGTCGAGTGCACGGGATCCAACGACGCCATGCTCGTCGGTAACCTCGTCGCCCTCTTGTCACC
TCTGGTCCTGGTGCCGGCGCTGTGCGTAGCCTTTGGCTTCGATAATTACGACTGGGCCTCCATGGCAGCCATCCG
CAGGGCCAACGACGACGACGTCCTTGGCGGCTCTAACCTACGTGCGATGGCGAGGACGCACGACGCCGAAGCCTC
CACGGAGCGACGCAAACTCGACCGGGCTTTTAAGCTGGCCAGCGTCGTCACCGTCAGCATGTGAGCGAACCCCGC
CCCCTTGGAGATGGTGACTGACAAAGACGAGACAGGGCATTGTCCTTACTGGTGCTCTGGCCGATGCCCATGTAC
GGCTCTGGCTACATCTTCTCTCGAAGCTTCTTCACCGGGTGGGTGGCGGTCGGTATTGCGTGGATCTTTGGCTCA
TTGGTCGCCGTAGGTCTGTATCCGTTGTGGGAGAGCCGGGTGACGCTTTGGCGAATCGTTAGATCGATGCTAAGG
GGCAAGCGGGCGGCGGCAGTCGTCAAGGATGGGGAAACGGACGAAGTCAAAGGCCGTGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail