Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5405
Gene name
Locationscaffold_440:4595..5869
Strand-
Gene length (bp)1274
Transcript length (bp)1029
Coding sequence length (bp)1026
Protein length (aa) 342

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09084 NMT1 NMT1/THI5 like 2.6E-73 16 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P42882|NMT1_ASPPA 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase OS=Aspergillus parasiticus GN=nmt1 PE=2 SV=1 1 336 0.0E+00
sp|O00057|NMT1_UROFA 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase OS=Uromyces fabae GN=PIG1 PE=2 SV=1 1 332 6.0E-157
sp|Q07748|THI13_YEAST 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI13 PE=1 SV=1 1 336 2.0E-155
sp|P43534|THI5_YEAST 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI5 PE=1 SV=1 1 336 4.0E-155
sp|P42883|THI12_YEAST 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI12 PE=3 SV=1 1 336 6.0E-155
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P42882|NMT1_ASPPA 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase OS=Aspergillus parasiticus GN=nmt1 PE=2 SV=1 1 336 0.0E+00
sp|O00057|NMT1_UROFA 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase OS=Uromyces fabae GN=PIG1 PE=2 SV=1 1 332 6.0E-157
sp|Q07748|THI13_YEAST 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI13 PE=1 SV=1 1 336 2.0E-155
sp|P43534|THI5_YEAST 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI5 PE=1 SV=1 1 336 4.0E-155
sp|P42883|THI12_YEAST 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI12 PE=3 SV=1 1 336 6.0E-155
sp|P47183|THI11_YEAST 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI11 PE=1 SV=1 1 336 2.0E-154
sp|C4YMW2|THI5_CANAW 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase OS=Candida albicans (strain WO-1) GN=THI5 PE=1 SV=1 1 336 2.0E-151
sp|P36597|NMT1_SCHPO 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nmt1 PE=2 SV=1 1 332 6.0E-151
sp|Q5A3Y5|THI5_CANAL 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=THI13 PE=1 SV=1 1 336 2.0E-149
sp|P44658|Y357_HAEIN Putative thiamine biosynthesis protein HI_0357 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0357 PE=1 SV=1 2 289 2.0E-27
sp|Q9K9G5|THIY_BACHD Formylaminopyrimidine-binding protein OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=thiY PE=1 SV=1 4 238 8.0E-13
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6334 0.5235 0.0747 0.1835 0.232 0.0349 0.0238 0.1096 0.0406 0.363

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2040
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6835
Ophiocordyceps australis map64 (Brazil) OphauB2|4525
Ophiocordyceps camponoti-floridani Ophcf2|01059
Ophiocordyceps camponoti-rufipedis Ophun1|6676
Ophiocordyceps kimflemingae Ophio5|5405 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2328

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5405
MSTEKITFLTNWHATPYHAPLYLAQAKGYFRDEGIQVAILEPNDPSDVTEIIGSGKADLGFKAMIHTLAAKARRF
PVLSIGSLLDEPFTGVIHLATSGIGADLESLAGKRIGYVGEFGKLQVDELMSRYGLSPADYTAVRCGMNVSSALI
KGEIDAGIGLDNVQMVEIEEWLASQGRDRSEVQMLRIDELAELGCCCFCSILYIGNETFIDQNPDRVRAFMRAVK
RATDLVLADPHAAWEQYVDAKPVMAGRLNRTMFERSFAFFSPDLKNVSRDWAKVTKYGQRLGVLGPDFVPNYTND
FLGWTLEPDSPDPAGDQRRMAELQRDVACRGGFRRLPATVRV
Coding >Ophio5|5405
ATGTCGACGGAAAAAATTACCTTCCTGACCAACTGGCATGCCACGCCATATCATGCGCCGCTCTACTTGGCTCAG
GCCAAGGGCTACTTCCGCGATGAAGGCATTCAGGTCGCCATTCTCGAGCCCAACGATCCGAGTGACGTCACAGAG
ATCATCGGAAGCGGCAAGGCAGACCTGGGCTTCAAGGCCATGATCCACACGCTCGCTGCCAAGGCACGCCGCTTC
CCCGTCCTGTCCATCGGCAGCCTCCTGGACGAGCCCTTCACGGGCGTCATCCACCTCGCGACATCGGGCATCGGC
GCCGACCTCGAATCCCTCGCCGGAAAACGCATTGGCTACGTCGGCGAGTTCGGAAAGCTTCAAGTGGACGAGCTG
ATGTCACGATACGGTCTCTCGCCCGCCGACTACACGGCCGTTCGTTGCGGCATGAATGTCTCGTCGGCGCTCATC
AAGGGGGAAATTGACGCCGGTATCGGTCTCGATAACGTGCAGATGGTCGAGATCGAGGAGTGGCTCGCTTCTCAG
GGCCGGGACAGGTCCGAGGTGCAAATGTTGCGCATCGATGAACTGGCTGAGCTCGGATGCTGCTGCTTCTGCTCC
ATTCTCTACATCGGCAACGAGACCTTCATCGACCAGAACCCGGACCGGGTCCGTGCCTTTATGCGTGCCGTCAAG
CGCGCCACCGACTTGGTCCTGGCGGATCCTCATGCCGCATGGGAGCAGTATGTTGATGCCAAGCCCGTCATGGCT
GGCCGCCTCAACCGTACCATGTTCGAACGCAGCTTTGCCTTCTTCTCGCCCGACCTGAAGAACGTCTCGCGCGAT
TGGGCCAAGGTTACCAAATATGGCCAGCGCCTCGGTGTCCTCGGTCCTGACTTTGTGCCCAACTATACCAACGAC
TTCCTCGGCTGGACCCTCGAACCCGACTCTCCTGATCCGGCCGGAGACCAGAGGCGTATGGCCGAGCTACAAAGG
GATGTGGCCTGCCGCGGCGGCTTTCGAAGGCTTCCGGCTACCGTCAGGGTG
Transcript >Ophio5|5405
ATGTCGACGGAAAAAATTACCTTCCTGACCAACTGGCATGCCACGCCATATCATGCGCCGCTCTACTTGGCTCAG
GCCAAGGGCTACTTCCGCGATGAAGGCATTCAGGTCGCCATTCTCGAGCCCAACGATCCGAGTGACGTCACAGAG
ATCATCGGAAGCGGCAAGGCAGACCTGGGCTTCAAGGCCATGATCCACACGCTCGCTGCCAAGGCACGCCGCTTC
CCCGTCCTGTCCATCGGCAGCCTCCTGGACGAGCCCTTCACGGGCGTCATCCACCTCGCGACATCGGGCATCGGC
GCCGACCTCGAATCCCTCGCCGGAAAACGCATTGGCTACGTCGGCGAGTTCGGAAAGCTTCAAGTGGACGAGCTG
ATGTCACGATACGGTCTCTCGCCCGCCGACTACACGGCCGTTCGTTGCGGCATGAATGTCTCGTCGGCGCTCATC
AAGGGGGAAATTGACGCCGGTATCGGTCTCGATAACGTGCAGATGGTCGAGATCGAGGAGTGGCTCGCTTCTCAG
GGCCGGGACAGGTCCGAGGTGCAAATGTTGCGCATCGATGAACTGGCTGAGCTCGGATGCTGCTGCTTCTGCTCC
ATTCTCTACATCGGCAACGAGACCTTCATCGACCAGAACCCGGACCGGGTCCGTGCCTTTATGCGTGCCGTCAAG
CGCGCCACCGACTTGGTCCTGGCGGATCCTCATGCCGCATGGGAGCAGTATGTTGATGCCAAGCCCGTCATGGCT
GGCCGCCTCAACCGTACCATGTTCGAACGCAGCTTTGCCTTCTTCTCGCCCGACCTGAAGAACGTCTCGCGCGAT
TGGGCCAAGGTTACCAAATATGGCCAGCGCCTCGGTGTCCTCGGTCCTGACTTTGTGCCCAACTATACCAACGAC
TTCCTCGGCTGGACCCTCGAACCCGACTCTCCTGATCCGGCCGGAGACCAGAGGCGTATGGCCGAGCTACAAAGG
GATGTGGCCTGCCGCGGCGGCTTTCGAAGGCTTCCGGCTACCGTCAGGGTGTAA
Gene >Ophio5|5405
ATGTCGACGGAAAAAATTACCTTCCTGACCAACTGGTAAGGGTCGGTATCGTCCTTTGGGGAATACACGTGCGGC
ACTGACACCTACCAATTGCAAGGCATGCCACGCCATATCATGCGCCGCTCTACTTGGCTCAGGCCAAGGGCTACT
TCCGCGATGAAGGCATTCAGGTCGCCATTCTCGAGCCCAACGATCCGAGTGTGAGAGTCTTTTTTTCTATTGATC
TGGTCCCAAGCGGCTTACGCGTCTCATGCAGGACGTCACAGAGATCATCGGAAGCGGCAAGGCAGACCTGGGCTT
CAAGGCCATGATCCACACGCTCGCTGTATGATTCTTCCCCCCCCCCCACCCCCCCCCCCACCCCCCTCNNCCCCC
CCCCCCCCCCGTCTATACCATTCCAATCTTCCTCGTCCTCCTCACGCGTTCAAGAATCTGACTCGGGCATATAAC
AGGCCAAGGCACGCCGCTTCCCCGTCCTGTCCATCGGCAGCCTCCTGGACGAGCCCTTCACGGGCGTCATCCACC
TCGCGACATCGGGCATCGGCGCCGACCTCGAATCCCTCGCCGGAAAACGCATTGGCTACGTCGGCGAGTTCGGAA
AGCTTCAAGTGGACGAGCTGATGTCACGATACGGTCTCTCGCCCGCCGACTACACGGCCGTTCGTTGCGGCATGA
ATGTCTCGTCGGCGCTCATCAAGGGGGAAATTGACGCCGGTATCGGTCTCGATAACGTGCAGATGGTCGAGATCG
AGGAGTGGCTCGCTTCTCAGGGCCGGGACAGGTCCGAGGTGCAAATGTTGCGCATCGATGAACTGGCTGAGCTCG
GATGCTGCTGCTTCTGCTCCATTCTCTACATCGGCAACGAGACCTTCATCGACCAGAACCCGGACCGGGTCCGTG
CCTTTATGCGTGCCGTCAAGCGCGCCACCGACTTGGTCCTGGCGGATCCTCATGCCGCATGGGAGCAGTATGTTG
ATGCCAAGCCCGTCATGGCTGGCCGCCTCAACCGTACCATGTTCGAACGCAGCTTTGCCTTCTTCTCGCCCGACC
TGAAGAACGTCTCGCGCGATTGGGCCAAGGTTACCAAATATGGCCAGCGCCTCGGTGTCCTCGGTCCTGACTTTG
TGCCCAACTATACCAACGACTTCCTCGGCTGGACCCTCGAACCCGACTCTCCTGATCCGGCCGGAGACCAGAGGC
GTATGGCCGAGCTACAAAGGGATGTGGCCTGCCGCGGCGGCTTTCGAAGGCTTCCGGCTACCGTCAGGGTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail