Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5401
Gene name
Locationscaffold_44:54114..55204
Strand+
Gene length (bp)1090
Transcript length (bp)978
Coding sequence length (bp)975
Protein length (aa) 325

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AK17|PLCX1_ARTBC PI-PLC X domain-containing protein 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04618 PE=1 SV=1 57 325 1.0E-80
sp|D4AUX6|A8043_ARTBC Uncharacterized secreted protein ARB_08043 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_08043 PE=1 SV=1 51 318 4.0E-54
sp|Q9NUJ7|PLCX1_HUMAN PI-PLC X domain-containing protein 1 OS=Homo sapiens GN=PLCXD1 PE=2 SV=1 90 228 2.0E-07
sp|Q93XX5|Y5713_ARATH PI-PLC X domain-containing protein At5g67130 OS=Arabidopsis thaliana GN=At5g67130 PE=1 SV=1 65 325 4.0E-06
sp|Q8CHS4|PLCX1_MOUSE PI-PLC X domain-containing protein 1 OS=Mus musculus GN=Plcxd1 PE=2 SV=1 89 228 9.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5401
MLRLGIALGLVRLSAALLIPAPPASHQAALRAPDLDSSALDSSAPLPAATPATPRACNGHEKLCGRRYSDVTMIG
THNSAFVGDTPFHNQFVSLTEQLDMGVRFLTAQTHNRLGRIELCHTSCWELDVGPLSSYLHELAHWIDNHPDDVV
TLLLTNMEAISMDKFDEDLVAAGLAEYAFRPGGSVVARDGWPTLQQLLNAGTRLVVFMDYHADLSKTDCILPEFD
YFWETPYGITDDEFPTCSVDRPSGGDPDRLMGVMNHMLNFQLGDIVFPNMLDAATTNSLASIQKQVDLCKSQGKP
QPNVVLLDWANIGEAQKAHQVLNAL
Coding >Ophio5|5401
ATGTTGCGTCTCGGCATAGCCCTCGGCCTCGTCCGCCTATCGGCGGCGCTACTCATCCCGGCCCCTCCGGCTTCC
CATCAGGCAGCGCTGCGCGCCCCGGACCTTGACTCTTCAGCCCTTGATTCATCGGCCCCTCTTCCGGCGGCGACA
CCGGCTACCCCCCGGGCGTGTAACGGCCACGAGAAACTCTGCGGGCGGCGCTACTCGGATGTGACCATGATAGGC
ACACACAACAGCGCCTTCGTCGGCGACACGCCCTTTCACAACCAGTTCGTCTCGCTGACGGAGCAGCTCGACATG
GGAGTGCGCTTCCTGACGGCGCAGACGCACAACAGGCTGGGCCGCATCGAGCTGTGCCACACGTCGTGCTGGGAG
CTCGACGTCGGTCCCTTGTCCTCTTACCTGCACGAGCTGGCGCACTGGATCGATAACCATCCTGACGATGTGGTT
ACGCTGCTGCTCACTAACATGGAAGCCATTTCGATGGACAAGTTTGACGAGGACCTTGTTGCTGCGGGCCTGGCC
GAGTATGCGTTTCGTCCGGGCGGCAGCGTCGTGGCCCGCGATGGCTGGCCGACGCTACAGCAACTGCTAAACGCG
GGGACGCGCCTCGTCGTCTTTATGGACTACCACGCCGACCTGTCCAAGACGGACTGTATCCTGCCCGAGTTTGAC
TACTTCTGGGAGACGCCGTACGGCATCACCGACGACGAGTTTCCGACGTGCAGCGTCGACCGGCCGTCGGGCGGC
GACCCGGATCGGCTGATGGGGGTGATGAACCACATGCTCAACTTTCAGCTTGGCGATATTGTCTTTCCCAATATG
CTGGACGCTGCGACGACGAATTCGCTGGCGTCGATTCAGAAGCAGGTTGATCTGTGCAAGAGTCAGGGGAAGCCA
CAGCCTAATGTAGTGCTGCTTGACTGGGCGAATATCGGCGAGGCGCAAAAGGCGCACCAGGTTCTCAACGCGCTG
Transcript >Ophio5|5401
ATGTTGCGTCTCGGCATAGCCCTCGGCCTCGTCCGCCTATCGGCGGCGCTACTCATCCCGGCCCCTCCGGCTTCC
CATCAGGCAGCGCTGCGCGCCCCGGACCTTGACTCTTCAGCCCTTGATTCATCGGCCCCTCTTCCGGCGGCGACA
CCGGCTACCCCCCGGGCGTGTAACGGCCACGAGAAACTCTGCGGGCGGCGCTACTCGGATGTGACCATGATAGGC
ACACACAACAGCGCCTTCGTCGGCGACACGCCCTTTCACAACCAGTTCGTCTCGCTGACGGAGCAGCTCGACATG
GGAGTGCGCTTCCTGACGGCGCAGACGCACAACAGGCTGGGCCGCATCGAGCTGTGCCACACGTCGTGCTGGGAG
CTCGACGTCGGTCCCTTGTCCTCTTACCTGCACGAGCTGGCGCACTGGATCGATAACCATCCTGACGATGTGGTT
ACGCTGCTGCTCACTAACATGGAAGCCATTTCGATGGACAAGTTTGACGAGGACCTTGTTGCTGCGGGCCTGGCC
GAGTATGCGTTTCGTCCGGGCGGCAGCGTCGTGGCCCGCGATGGCTGGCCGACGCTACAGCAACTGCTAAACGCG
GGGACGCGCCTCGTCGTCTTTATGGACTACCACGCCGACCTGTCCAAGACGGACTGTATCCTGCCCGAGTTTGAC
TACTTCTGGGAGACGCCGTACGGCATCACCGACGACGAGTTTCCGACGTGCAGCGTCGACCGGCCGTCGGGCGGC
GACCCGGATCGGCTGATGGGGGTGATGAACCACATGCTCAACTTTCAGCTTGGCGATATTGTCTTTCCCAATATG
CTGGACGCTGCGACGACGAATTCGCTGGCGTCGATTCAGAAGCAGGTTGATCTGTGCAAGAGTCAGGGGAAGCCA
CAGCCTAATGTAGTGCTGCTTGACTGGGCGAATATCGGCGAGGCGCAAAAGGCGCACCAGGTTCTCAACGCGCTG
TAG
Gene >Ophio5|5401
ATGTTGCGTCTCGGCATAGCCCTCGGCCTCGTCCGCCTATCGGCGGCGCTACTCATCCCGGCCCCTCCGGCTTCC
CATCAGGCAGCGCTGCGCGCCCCGGACCTTGACTCTTCAGCCCTTGATTCATCGGCCCCTCTTCCGGCGGCGACA
CCGGCTACCCCCCGGGCGTGTAACGGCCACGAGAAACTCTGCGGGCGGCGCTACTCGGATGTGACCATGATAGGC
ACACACAACAGCGCCTTCGTCGGCGACACGCCCTTTCACAACCAGTTCGTCTCGCTGACGGAGCAGCTCGACATG
GGAGTGCGCTTCCTGACGGCGCAGACGCACAACAGGCTGGGCCGCATCGAGCTGTGCCACACGTCGTGCTGGGAG
CTCGACGTCGGTCCCTTGTCCTCTTACCTGCACGAGCTGGCGCACTGGATCGATAACCATCCTGACGATGTGGTT
ACGCTGCTGCTCACTAACATGGAAGCCATTTCGATGGACAAGTTTGACGAGGACCTTGTTGCTGCGGGCCTGGCC
GAGTATGCGTTTCGTCCGGGCGGCAGCGTCGTGGCCCGCGATGGCTGGCCGACGCTACAGCAACTGCTAAACGCG
GGGACGCGCCTCGTCGTCTTTATGGGTAGGTTTTCTATCTTGTTGTTCACGACACAAACTCACAAGTGTGCAGAC
TACCACGCCGACCTGTCCAAGACGGACTGTATCCTGCCCGAGTTTGACTACTTCTGGGAGACGCCGTACGGCATC
ACCGACGACGAGTTTCCGACGTGCAGCGTCGACCGGCCGTCGGGCGGCGACCCGGATCGGCTGATGGGGGTGATG
AACCACATGCTCAACTTTCAGCTTGGCGATATTGTCTTTCCCAATATGCTGGACGCTGCGACGACGAATTCGCTG
GCGTCGATTCAGAAGCAGGTTGATCTGTGCAAGAGTCAGGGGAAGCCACAGCCTAATGTAGTGCTGGTGAGTTGC
TTTTTTTCTCTTTTATTTTATTTTTTTCTTTGTCTCTGCTGACGATGAGGTGCAGCTTGACTGGGCGAATATCGG
CGAGGCGCAAAAGGCGCACCAGGTTCTCAACGCGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail