Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5400
Gene name
Locationscaffold_44:51853..52980
Strand-
Gene length (bp)1127
Transcript length (bp)1074
Coding sequence length (bp)1071
Protein length (aa) 357

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 2.0E-08 77 136

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P47442|DNAJM_MYCGE DnaJ-like protein MG200 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG200 PE=1 SV=1 76 145 5.0E-07
sp|A1STE5|DNAJ_PSYIN Chaperone protein DnaJ OS=Psychromonas ingrahamii (strain 37) GN=dnaJ PE=3 SV=1 73 146 7.0E-07
sp|P75354|DNAJM_MYCPN DnaJ-like protein MG200 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_119 PE=3 SV=1 72 145 2.0E-06
sp|Q5QXL2|DNAJ_IDILO Chaperone protein DnaJ OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=dnaJ PE=3 SV=1 73 146 2.0E-06
sp|B9LUC6|DNAJ_HALLT Chaperone protein DnaJ OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=dnaJ PE=3 SV=1 76 142 3.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P47442|DNAJM_MYCGE DnaJ-like protein MG200 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG200 PE=1 SV=1 76 145 5.0E-07
sp|A1STE5|DNAJ_PSYIN Chaperone protein DnaJ OS=Psychromonas ingrahamii (strain 37) GN=dnaJ PE=3 SV=1 73 146 7.0E-07
sp|P75354|DNAJM_MYCPN DnaJ-like protein MG200 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_119 PE=3 SV=1 72 145 2.0E-06
sp|Q5QXL2|DNAJ_IDILO Chaperone protein DnaJ OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=dnaJ PE=3 SV=1 73 146 2.0E-06
sp|B9LUC6|DNAJ_HALLT Chaperone protein DnaJ OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=dnaJ PE=3 SV=1 76 142 3.0E-06
sp|A1JJD6|DNAJ_YERE8 Chaperone protein DnaJ OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dnaJ PE=3 SV=1 73 140 4.0E-06
sp|B9JZ89|DNAJ_AGRVS Chaperone protein DnaJ OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaJ PE=3 SV=1 73 140 4.0E-06
sp|Q6RSN5|DNAJ_RHIRD Chaperone protein DnaJ OS=Rhizobium radiobacter GN=dnaJ PE=1 SV=1 73 140 4.0E-06
sp|P25491|MAS5_YEAST Mitochondrial protein import protein MAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDJ1 PE=1 SV=1 74 144 4.0E-06
sp|Q5E3A8|DNAJ_VIBF1 Chaperone protein DnaJ OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dnaJ PE=3 SV=1 76 140 5.0E-06
sp|B2G6W4|DNAJ_LACRJ Chaperone protein DnaJ OS=Lactobacillus reuteri (strain JCM 1112) GN=dnaJ PE=3 SV=1 73 140 8.0E-06
sp|A5VJE8|DNAJ_LACRD Chaperone protein DnaJ OS=Lactobacillus reuteri (strain DSM 20016) GN=dnaJ PE=3 SV=1 73 140 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 159 181 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5400
MSHALSMIGWYILPSLATSVIQTIYYGLTIRAGDPKPAPESARHIAHRRNIKIAVVALYLLYTIFEAHHDIRAEP
SFYDELGVPLDAGEREIRSRFRRVAAMHHPDKTGGEDLGFFFMHLKVVSDTLQHTAKRFAYERFGPDSVEWPQCV
TIRDFVTRGLLISILPHYAIAAATIYLLGLTGYMETAKFHRWLMLAGLCLFELHAVTRPNFPAVVHIANVVATRL
PPYTPLLPFQVIKLAQKLVLTLYIGISQIGPLLVGQSAARRRAGPRDEKALEQALDRLELVSGQLDAETSRLVAL
EMSPFKGDENAIRNLRDKMREWLVQNTIRADPMVRDALGASLRKRRIDAPSGAKGNR
Coding >Ophio5|5400
ATGTCGCACGCCCTTTCTATGATAGGCTGGTATATCCTGCCCAGCCTCGCTACCTCGGTGATCCAGACCATCTAC
TACGGCCTCACGATCCGTGCAGGCGACCCCAAGCCCGCCCCCGAGTCGGCGCGCCATATTGCTCACCGTCGCAAT
ATCAAGATTGCTGTCGTCGCACTCTATCTGCTCTATACCATCTTCGAGGCCCATCACGATATCCGCGCCGAGCCC
TCCTTCTACGATGAACTCGGCGTGCCGCTCGACGCGGGCGAGCGCGAAATCCGCTCCCGCTTCCGCAGGGTCGCT
GCTATGCATCACCCGGACAAGACCGGCGGCGAGGACTTGGGGTTCTTCTTCATGCATCTCAAGGTTGTTAGCGAT
ACGCTGCAGCACACCGCGAAGCGGTTCGCATATGAGCGCTTCGGCCCTGATAGCGTCGAATGGCCCCAGTGCGTC
ACCATCCGCGACTTCGTCACCAGGGGCCTCCTCATCTCTATCCTTCCCCACTATGCCATCGCCGCTGCCACCATC
TACCTCCTCGGCCTCACTGGCTACATGGAGACGGCCAAGTTTCACCGCTGGCTGATGCTCGCTGGTCTCTGCCTC
TTTGAGCTCCACGCCGTTACACGGCCCAACTTTCCTGCCGTCGTACACATCGCCAACGTCGTCGCCACGCGCCTC
CCGCCCTACACCCCCTTGCTGCCCTTTCAAGTCATCAAGCTCGCTCAGAAGCTCGTCCTTACCCTCTACATCGGC
ATCTCCCAGATCGGGCCGCTCCTAGTGGGGCAGTCCGCCGCCCGCCGTCGCGCCGGACCTCGCGACGAAAAGGCT
CTTGAGCAGGCGCTCGATCGCCTCGAGCTTGTGTCCGGCCAGCTGGACGCGGAGACGAGTCGGCTGGTGGCACTA
GAAATGTCACCCTTCAAAGGCGACGAGAACGCGATTCGCAACCTCCGAGACAAGATGCGCGAATGGCTGGTGCAA
AATACGATACGCGCCGACCCCATGGTGCGTGACGCGCTGGGTGCATCGTTGAGGAAGAGGAGGATAGACGCCCCA
AGCGGTGCCAAGGGGAACAGA
Transcript >Ophio5|5400
ATGTCGCACGCCCTTTCTATGATAGGCTGGTATATCCTGCCCAGCCTCGCTACCTCGGTGATCCAGACCATCTAC
TACGGCCTCACGATCCGTGCAGGCGACCCCAAGCCCGCCCCCGAGTCGGCGCGCCATATTGCTCACCGTCGCAAT
ATCAAGATTGCTGTCGTCGCACTCTATCTGCTCTATACCATCTTCGAGGCCCATCACGATATCCGCGCCGAGCCC
TCCTTCTACGATGAACTCGGCGTGCCGCTCGACGCGGGCGAGCGCGAAATCCGCTCCCGCTTCCGCAGGGTCGCT
GCTATGCATCACCCGGACAAGACCGGCGGCGAGGACTTGGGGTTCTTCTTCATGCATCTCAAGGTTGTTAGCGAT
ACGCTGCAGCACACCGCGAAGCGGTTCGCATATGAGCGCTTCGGCCCTGATAGCGTCGAATGGCCCCAGTGCGTC
ACCATCCGCGACTTCGTCACCAGGGGCCTCCTCATCTCTATCCTTCCCCACTATGCCATCGCCGCTGCCACCATC
TACCTCCTCGGCCTCACTGGCTACATGGAGACGGCCAAGTTTCACCGCTGGCTGATGCTCGCTGGTCTCTGCCTC
TTTGAGCTCCACGCCGTTACACGGCCCAACTTTCCTGCCGTCGTACACATCGCCAACGTCGTCGCCACGCGCCTC
CCGCCCTACACCCCCTTGCTGCCCTTTCAAGTCATCAAGCTCGCTCAGAAGCTCGTCCTTACCCTCTACATCGGC
ATCTCCCAGATCGGGCCGCTCCTAGTGGGGCAGTCCGCCGCCCGCCGTCGCGCCGGACCTCGCGACGAAAAGGCT
CTTGAGCAGGCGCTCGATCGCCTCGAGCTTGTGTCCGGCCAGCTGGACGCGGAGACGAGTCGGCTGGTGGCACTA
GAAATGTCACCCTTCAAAGGCGACGAGAACGCGATTCGCAACCTCCGAGACAAGATGCGCGAATGGCTGGTGCAA
AATACGATACGCGCCGACCCCATGGTGCGTGACGCGCTGGGTGCATCGTTGAGGAAGAGGAGGATAGACGCCCCA
AGCGGTGCCAAGGGGAACAGATAG
Gene >Ophio5|5400
ATGTCGCACGCCCTTTCTATGATAGGCTGGTATATCCTGCCCAGCGTACGTCTGTCTTGCCCTCGCTCGCCCTCA
CGCGGCAGCTGACATCTTGAAAGCTCGCTACCTCGGTGATCCAGACCATCTACTACGGCCTCACGATCCGTGCAG
GCGACCCCAAGCCCGCCCCCGAGTCGGCGCGCCATATTGCTCACCGTCGCAATATCAAGATTGCTGTCGTCGCAC
TCTATCTGCTCTATACCATCTTCGAGGCCCATCACGATATCCGCGCCGAGCCCTCCTTCTACGATGAACTCGGCG
TGCCGCTCGACGCGGGCGAGCGCGAAATCCGCTCCCGCTTCCGCAGGGTCGCTGCTATGCATCACCCGGACAAGA
CCGGCGGCGAGGACTTGGGGTTCTTCTTCATGCATCTCAAGGTTGTTAGCGATACGCTGCAGCACACCGCGAAGC
GGTTCGCATATGAGCGCTTCGGCCCTGATAGCGTCGAATGGCCCCAGTGCGTCACCATCCGCGACTTCGTCACCA
GGGGCCTCCTCATCTCTATCCTTCCCCACTATGCCATCGCCGCTGCCACCATCTACCTCCTCGGCCTCACTGGCT
ACATGGAGACGGCCAAGTTTCACCGCTGGCTGATGCTCGCTGGTCTCTGCCTCTTTGAGCTCCACGCCGTTACAC
GGCCCAACTTTCCTGCCGTCGTACACATCGCCAACGTCGTCGCCACGCGCCTCCCGCCCTACACCCCCTTGCTGC
CCTTTCAAGTCATCAAGCTCGCTCAGAAGCTCGTCCTTACCCTCTACATCGGCATCTCCCAGATCGGGCCGCTCC
TAGTGGGGCAGTCCGCCGCCCGCCGTCGCGCCGGACCTCGCGACGAAAAGGCTCTTGAGCAGGCGCTCGATCGCC
TCGAGCTTGTGTCCGGCCAGCTGGACGCGGAGACGAGTCGGCTGGTGGCACTAGAAATGTCACCCTTCAAAGGCG
ACGAGAACGCGATTCGCAACCTCCGAGACAAGATGCGCGAATGGCTGGTGCAAAATACGATACGCGCCGACCCCA
TGGTGCGTGACGCGCTGGGTGCATCGTTGAGGAAGAGGAGGATAGACGCCCCAAGCGGTGCCAAGGGGAACAGAT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail