Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5392
Gene name
Locationscaffold_44:18931..21022
Strand-
Gene length (bp)2091
Transcript length (bp)1692
Coding sequence length (bp)1689
Protein length (aa) 563

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.7E-25 107 507
PF00083 Sugar_tr Sugar (and other) transporter 1.7E-10 138 276

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 48 556 1.0E-57
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 41 548 6.0E-47
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 57 549 2.0E-12
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 32 501 4.0E-11
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 258 548 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 48 556 1.0E-57
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 41 548 6.0E-47
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 57 549 2.0E-12
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 32 501 4.0E-11
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 258 548 2.0E-10
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 80 521 3.0E-09
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 66 466 1.0E-08
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 67 507 2.0E-08
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 47 484 3.0E-08
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 67 507 7.0E-08
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 80 507 2.0E-07
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 68 248 3.0E-07
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 369 529 6.0E-07
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 155 328 9.0E-07
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 79 269 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 96 118 22
2 133 155 22
3 162 179 17
4 194 216 22
5 223 245 22
6 249 271 22
7 343 365 22
8 385 407 22
9 428 450 22
10 454 473 19
11 480 502 22
12 522 544 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5392
MPPRLSRLGILLRGSPPSPVSLVPSSFATVCSRRDVRTNRMANRGNLAHADPPPGTVELLAEHGADGKDGEVVLI
PAPSDDPNDPLRWPMWRKCLHFGLLVAMTTAIFTSLSIQTIFWTQMEQDMINVTIQDLANAQAVQLVGLAVGCVV
FMPPATKYGRRSVYIIVMAIAAISAWWSAVMKTVPELFVANFLIGISGAVNQTAIAMTIHDIWFVHQRGTANGMF
FAGLMTGSFLCPMAAGVQGIKDGWRVSYATLAAAMTVLTVIFVIALEETKFIRPDQEAIPKDKQDMFKLESFQSE
LARSATDKASKKRGGCLQKARLQFVTKSDESLWKIFYYPALSWWFPQVIFASLQLGSSICWLVVLGSMISIVFSA
PPYNFDAAGLGYMYAGPCVGAIFGALYGGPLVDKAIVWLSRRNHGWFEPEMRLWLYPIPALAMAGGLVLFGVSAG
QGMHFVIPSVGGALFSFSFGAISDIATALVLDSFPAIVPQTFVAITFFRNAISMVGPFSVTPWSEAMGTTNMFIV
AAAISLAVNALALPLGIWGKKGRAAVAARYHRLADQSV
Coding >Ophio5|5392
ATGCCGCCTCGTCTCAGCCGCCTCGGTATTTTACTACGAGGCAGCCCGCCGAGTCCAGTCAGCTTGGTTCCCTCT
TCATTTGCTACTGTATGCTCGCGGCGCGACGTACGGACGAACCGAATGGCGAATCGTGGCAATCTAGCACACGCG
GACCCTCCTCCGGGGACCGTCGAGTTGCTGGCCGAGCACGGAGCGGACGGCAAGGATGGGGAGGTGGTCTTGATC
CCGGCCCCTTCTGATGACCCCAACGATCCTCTGCGATGGCCCATGTGGCGCAAATGCCTTCACTTTGGCCTCCTC
GTAGCCATGACGACGGCCATCTTCACGAGCCTCTCGATCCAGACCATCTTCTGGACGCAGATGGAACAAGACATG
ATCAACGTGACGATCCAGGATCTCGCCAACGCGCAGGCCGTCCAGCTGGTAGGACTGGCCGTCGGCTGCGTCGTA
TTCATGCCCCCAGCTACCAAATACGGCCGACGATCTGTCTACATCATCGTCATGGCCATCGCCGCCATATCAGCC
TGGTGGTCGGCCGTCATGAAGACGGTACCGGAGCTCTTTGTTGCCAACTTCCTCATCGGCATCTCTGGCGCCGTC
AATCAGACGGCCATTGCCATGACTATCCACGACATTTGGTTCGTCCATCAGCGAGGCACCGCCAACGGCATGTTC
TTTGCCGGCCTCATGACCGGCTCCTTTCTCTGCCCCATGGCTGCCGGTGTACAGGGCATCAAAGACGGATGGCGC
GTCTCGTACGCGACTCTAGCAGCAGCCATGACCGTCCTGACCGTCATCTTCGTCATAGCCCTCGAAGAGACCAAG
TTCATCCGGCCGGATCAAGAGGCCATACCGAAAGATAAACAAGACATGTTCAAGTTGGAATCTTTCCAGTCGGAG
CTGGCAAGGAGCGCTACGGACAAGGCGAGCAAGAAAAGGGGGGGCTGTCTCCAGAAGGCCAGGCTTCAGTTCGTT
ACCAAGTCGGACGAATCCCTTTGGAAAATCTTTTACTACCCGGCCTTGTCCTGGTGGTTTCCCCAAGTCATTTTC
GCCTCCTTGCAGCTGGGCTCGAGCATCTGCTGGCTGGTCGTCTTGGGGTCCATGATCTCCATCGTCTTCTCCGCC
CCTCCCTACAACTTTGACGCGGCCGGTCTCGGATACATGTACGCTGGGCCGTGTGTCGGTGCCATATTTGGCGCT
CTTTACGGTGGTCCGCTGGTCGACAAGGCCATAGTGTGGCTCTCACGACGAAACCATGGTTGGTTCGAGCCTGAG
ATGCGCCTCTGGCTGTATCCCATTCCCGCCCTGGCCATGGCCGGCGGTTTGGTGCTCTTTGGCGTCTCGGCTGGT
CAGGGCATGCACTTTGTCATCCCCAGCGTTGGAGGAGCTCTCTTTTCCTTTTCCTTTGGCGCCATCTCCGACATC
GCAACGGCCCTCGTTCTGGATTCCTTCCCAGCTATTGTGCCTCAAACCTTTGTGGCCATCACCTTCTTCCGCAAC
GCCATCAGCATGGTTGGCCCCTTTTCCGTCACGCCCTGGTCCGAGGCCATGGGGACGACCAACATGTTCATCGTG
GCGGCTGCCATCAGCCTGGCAGTCAACGCACTGGCACTGCCCCTCGGCATATGGGGCAAGAAAGGCAGGGCTGCC
GTGGCAGCTCGCTATCATCGCTTGGCAGACCAAAGCGTA
Transcript >Ophio5|5392
ATGCCGCCTCGTCTCAGCCGCCTCGGTATTTTACTACGAGGCAGCCCGCCGAGTCCAGTCAGCTTGGTTCCCTCT
TCATTTGCTACTGTATGCTCGCGGCGCGACGTACGGACGAACCGAATGGCGAATCGTGGCAATCTAGCACACGCG
GACCCTCCTCCGGGGACCGTCGAGTTGCTGGCCGAGCACGGAGCGGACGGCAAGGATGGGGAGGTGGTCTTGATC
CCGGCCCCTTCTGATGACCCCAACGATCCTCTGCGATGGCCCATGTGGCGCAAATGCCTTCACTTTGGCCTCCTC
GTAGCCATGACGACGGCCATCTTCACGAGCCTCTCGATCCAGACCATCTTCTGGACGCAGATGGAACAAGACATG
ATCAACGTGACGATCCAGGATCTCGCCAACGCGCAGGCCGTCCAGCTGGTAGGACTGGCCGTCGGCTGCGTCGTA
TTCATGCCCCCAGCTACCAAATACGGCCGACGATCTGTCTACATCATCGTCATGGCCATCGCCGCCATATCAGCC
TGGTGGTCGGCCGTCATGAAGACGGTACCGGAGCTCTTTGTTGCCAACTTCCTCATCGGCATCTCTGGCGCCGTC
AATCAGACGGCCATTGCCATGACTATCCACGACATTTGGTTCGTCCATCAGCGAGGCACCGCCAACGGCATGTTC
TTTGCCGGCCTCATGACCGGCTCCTTTCTCTGCCCCATGGCTGCCGGTGTACAGGGCATCAAAGACGGATGGCGC
GTCTCGTACGCGACTCTAGCAGCAGCCATGACCGTCCTGACCGTCATCTTCGTCATAGCCCTCGAAGAGACCAAG
TTCATCCGGCCGGATCAAGAGGCCATACCGAAAGATAAACAAGACATGTTCAAGTTGGAATCTTTCCAGTCGGAG
CTGGCAAGGAGCGCTACGGACAAGGCGAGCAAGAAAAGGGGGGGCTGTCTCCAGAAGGCCAGGCTTCAGTTCGTT
ACCAAGTCGGACGAATCCCTTTGGAAAATCTTTTACTACCCGGCCTTGTCCTGGTGGTTTCCCCAAGTCATTTTC
GCCTCCTTGCAGCTGGGCTCGAGCATCTGCTGGCTGGTCGTCTTGGGGTCCATGATCTCCATCGTCTTCTCCGCC
CCTCCCTACAACTTTGACGCGGCCGGTCTCGGATACATGTACGCTGGGCCGTGTGTCGGTGCCATATTTGGCGCT
CTTTACGGTGGTCCGCTGGTCGACAAGGCCATAGTGTGGCTCTCACGACGAAACCATGGTTGGTTCGAGCCTGAG
ATGCGCCTCTGGCTGTATCCCATTCCCGCCCTGGCCATGGCCGGCGGTTTGGTGCTCTTTGGCGTCTCGGCTGGT
CAGGGCATGCACTTTGTCATCCCCAGCGTTGGAGGAGCTCTCTTTTCCTTTTCCTTTGGCGCCATCTCCGACATC
GCAACGGCCCTCGTTCTGGATTCCTTCCCAGCTATTGTGCCTCAAACCTTTGTGGCCATCACCTTCTTCCGCAAC
GCCATCAGCATGGTTGGCCCCTTTTCCGTCACGCCCTGGTCCGAGGCCATGGGGACGACCAACATGTTCATCGTG
GCGGCTGCCATCAGCCTGGCAGTCAACGCACTGGCACTGCCCCTCGGCATATGGGGCAAGAAAGGCAGGGCTGCC
GTGGCAGCTCGCTATCATCGCTTGGCAGACCAAAGCGTATAA
Gene >Ophio5|5392
ATGCCGCCTCGTCTCAGCCGCCTCGGTATTTTACTACGAGGCAGCCCGCCGAGTCCAGTCAGCTTGGTTCCCTCT
TCATTTGCTACTGTATGCTCGCGGCGCGACGTACGGACGAACCGAATGGCGAATCGTGGCAATCTAGCACACGCG
GACCCTCCTCCGGGGACCGTCGAGTTGCTGGCCGGTGCGTGTTGTCGACCTGTCTGCTGCTGATATCTTGCCTGA
CCCATCATTCATCTTTTTTCTTCTTCTCAGAGCACGGAGCGGACGGCAAGGATGGGGAGGTGGTCTTGATCCCGG
CCCCTTCTGATGACCCCAACGATCCTCTGGTCAGTCCCTCCTGTCTTATTCTGCCGCGAAGGGGGGGGATGGCGA
TGCTCACTCTTTTGTTCAGCGATGGCCCATGTGGCGCAAATGCCTTCACTTTGGCCTCCTCGTAGCCATGACGAC
GGCCATCTTCACGAGGTAAAGAGAAAAAAAAAAAGGCTTGATGACGGCGGCTGCTGACGGCCAACTATAATCAGC
CTCTCGATCCAGACCATCTTCTGGACGCAGATGGAACAAGACATGATCAACGTGACGATCCAGGATCTCGCCAAC
GCGCAGGCCGTCCAGCTGGTAGGACTGGCCGTCGGCTGCGTCGTATTCATGCCCCCAGCTACCAAATACGGCCGA
CGATCTGTCTACATCATCGTCATGGCCATCGCCGCCATATCAGCCTGGTGGTCGGCCGTCATGAAGACGGTACCG
GAGCTCTTTGTTGCCAACTTCCTCATCGGCATCTCTGGCGCCGTCAATCAGACGGCCATTGCCATGACTGTAGGT
TTACCGTGCTTCTATTTCTCTGAGGCTATAGCAAAACCCTGACGTTTTTTTTTTATCTTTTTTAGATCCACGACA
TTTGGTTCGTCCATCAGCGAGGCACCGCCAACGGCATGTTCTTTGCCGGCCTCATGACCGGCTCCTTTCTCTGCC
CCATGGCTGCCGGTGTACAGGGCATCAAAGACGGATGGCGCGTCTCGTACGCGACTCTAGCAGCAGCCATGACCG
TCCTGACCGTCATCTTCGTCATAGCCCTCGAAGAGACCAAGTTCATCCGGCCGGATCAAGAGGCCATACCGAAAG
ATAAACAAGACATGTTCAAGTTGGAATCTTTCCAGTCGGAGCTGGCAAGGAGCGCTACGGACAAGGCGAGCAAGA
AAAGGGGGGGCTGTCTCCAGAAGGCCAGGCTTCAGTTCGTTACCAAGTCGGACGAATCCCTTTGGAAAATCTTTT
ACTACCCGGCCTTGTCCTGGTGGTTTCCCCAAGTCATTTTCGCCTCCTTGCAGCTGGGCTCGAGCATCTGCTGGC
TGGTCGTCTTGGGGTCCATGATCTCCATCGTCTTCTCCGCCCCTCCCTACAACTTTGACGCGGCCGGTCTCGGAT
ACATGTACGCTGGGCCGTGTGTCGGTGCCATATTTGGCGCTCTTTACGGTGGTCCGCTGGTCGACAAGGCCATAG
TGTGGCTCTCACGACGAAACCATGGTTGGTTCGAGCCTGAGATGCGCCTCTGGCTGTATCCCATTCCCGCCCTGG
CCATGGCCGGCGGTTTGGTGCTCTTTGGCGTCTCGGCTGGTCAGGTGAGAGGCTCTCGAGACTACGACTACCCTT
CTCTTCTGAAGCTAACGTGAACCTGTAAGGGCATGCACTTTGTCATCCCCAGCGTTGGAGGAGCTCTCTTTTCCT
TTTCCTTTGGCGCCATCTCCGACATCGCAACGGCCCTCGTTCTGGATTCCTTCCCAGCTGTGAGTCCAATCTCCT
CTCTCGAACCAGCCCCGACGGTTGGTTGGTGGTCACAAGCTGACGACGCATGGCTAGATTGTGCCTCAAACCTTT
GTGGCCATCACCTTCTTCCGCAACGCCATCAGCATGGTTGGCCCCTTTTCCGTCACGCCCTGGTCCGAGGCCATG
GGGACGACCAACATGTTCATCGTGGCGGCTGCCATCAGCCTGGCAGTCAACGCACTGGCACTGCCCCTCGGCATA
TGGGGCAAGAAAGGCAGGGCTGCCGTGGCAGCTCGCTATCATCGCTTGGCAGACCAAAGCGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail