Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5388
Gene name
Locationscaffold_44:8528..10371
Strand+
Gene length (bp)1843
Transcript length (bp)1614
Coding sequence length (bp)1611
Protein length (aa) 537

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 1.4E-85 45 476
PF00324 AA_permease Amino acid permease 2.3E-15 58 487

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50276|MUP1_YEAST High-affinity methionine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MUP1 PE=1 SV=1 40 521 2.0E-168
sp|P38734|MUP3_YEAST Low-affinity methionine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MUP3 PE=1 SV=1 20 523 8.0E-68
sp|P82251|BAT1_HUMAN b(0,+)-type amino acid transporter 1 OS=Homo sapiens GN=SLC7A9 PE=1 SV=1 42 454 2.0E-34
sp|Q9N1R6|BAT1_RABIT b(0,+)-type amino acid transporter 1 OS=Oryctolagus cuniculus GN=SLC7A9 PE=1 SV=1 42 454 5.0E-34
sp|Q9WTR6|XCT_MOUSE Cystine/glutamate transporter OS=Mus musculus GN=Slc7a11 PE=1 SV=1 42 450 8.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50276|MUP1_YEAST High-affinity methionine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MUP1 PE=1 SV=1 40 521 2.0E-168
sp|P38734|MUP3_YEAST Low-affinity methionine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MUP3 PE=1 SV=1 20 523 8.0E-68
sp|P82251|BAT1_HUMAN b(0,+)-type amino acid transporter 1 OS=Homo sapiens GN=SLC7A9 PE=1 SV=1 42 454 2.0E-34
sp|Q9N1R6|BAT1_RABIT b(0,+)-type amino acid transporter 1 OS=Oryctolagus cuniculus GN=SLC7A9 PE=1 SV=1 42 454 5.0E-34
sp|Q9WTR6|XCT_MOUSE Cystine/glutamate transporter OS=Mus musculus GN=Slc7a11 PE=1 SV=1 42 450 8.0E-34
sp|Q9QXA6|BAT1_MOUSE b(0,+)-type amino acid transporter 1 OS=Mus musculus GN=Slc7a9 PE=1 SV=1 22 352 8.0E-33
sp|P82252|BAT1_RAT b(0,+)-type amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a9 PE=1 SV=1 42 352 3.0E-31
sp|Q9Z1K8|YLAT1_MOUSE Y+L amino acid transporter 1 OS=Mus musculus GN=Slc7a7 PE=1 SV=1 5 507 8.0E-31
sp|Q9R0S5|YLAT1_RAT Y+L amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a7 PE=1 SV=1 42 510 2.0E-30
sp|Q92536|YLAT2_HUMAN Y+L amino acid transporter 2 OS=Homo sapiens GN=SLC7A6 PE=1 SV=3 22 537 9.0E-30
sp|Q59I64|YLAT2_DANRE Y+L amino acid transporter 2 OS=Danio rerio GN=slc7a6 PE=2 SV=1 42 452 1.0E-29
sp|Q8BGK6|YLAT2_MOUSE Y+L amino acid transporter 2 OS=Mus musculus GN=Slc7a6 PE=1 SV=1 42 507 2.0E-29
sp|Q9UM01|YLAT1_HUMAN Y+L amino acid transporter 1 OS=Homo sapiens GN=SLC7A7 PE=1 SV=2 42 452 1.0E-27
sp|A1L3M3|YLAT2_XENLA Y+L amino acid transporter 2 OS=Xenopus laevis GN=slc7a6 PE=2 SV=1 22 519 9.0E-27
sp|Q9UPY5|XCT_HUMAN Cystine/glutamate transporter OS=Homo sapiens GN=SLC7A11 PE=1 SV=1 66 449 6.0E-26
sp|Q5RAG7|XCT_PONAB Cystine/glutamate transporter OS=Pongo abelii GN=SLC7A11 PE=2 SV=1 66 449 7.0E-26
sp|Q28I80|YLAT2_XENTR Y+L amino acid transporter 2 OS=Xenopus tropicalis GN=slc7a6 PE=2 SV=1 42 452 6.0E-25
sp|Q01650|LAT1_HUMAN Large neutral amino acids transporter small subunit 1 OS=Homo sapiens GN=SLC7A5 PE=1 SV=2 42 487 3.0E-24
sp|Q7YQK4|LAT1_RABIT Large neutral amino acids transporter small subunit 1 OS=Oryctolagus cuniculus GN=SLC7A5 PE=1 SV=1 42 487 1.0E-22
sp|Q9QXW9|LAT2_MOUSE Large neutral amino acids transporter small subunit 2 OS=Mus musculus GN=Slc7a8 PE=1 SV=1 42 487 1.0E-21
sp|Q9WVR6|LAT2_RAT Large neutral amino acids transporter small subunit 2 OS=Rattus norvegicus GN=Slc7a8 PE=1 SV=1 42 487 1.0E-21
sp|Q9UHI5|LAT2_HUMAN Large neutral amino acids transporter small subunit 2 OS=Homo sapiens GN=SLC7A8 PE=1 SV=1 42 487 2.0E-21
sp|Q5RAE3|LAT2_PONAB Large neutral amino acids transporter small subunit 2 OS=Pongo abelii GN=SLC7A8 PE=2 SV=2 42 487 2.0E-21
sp|Q9Z127|LAT1_MOUSE Large neutral amino acids transporter small subunit 1 OS=Mus musculus GN=Slc7a5 PE=1 SV=2 42 487 5.0E-21
sp|Q63016|LAT1_RAT Large neutral amino acids transporter small subunit 1 OS=Rattus norvegicus GN=Slc7a5 PE=1 SV=2 42 487 8.0E-21
sp|Q9N1Q4|LAT2_RABIT Large neutral amino acids transporter small subunit 2 OS=Oryctolagus cuniculus GN=SLC7A8 PE=1 SV=1 42 487 5.0E-20
sp|P63115|AAA1_MOUSE Asc-type amino acid transporter 1 OS=Mus musculus GN=Slc7a10 PE=1 SV=1 42 487 8.0E-19
sp|P63116|AAA1_RAT Asc-type amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a10 PE=2 SV=1 42 487 8.0E-19
sp|Q9NS82|AAA1_HUMAN Asc-type amino acid transporter 1 OS=Homo sapiens GN=SLC7A10 PE=2 SV=1 15 402 5.0E-18
sp|O34739|STET_BACSU Serine/threonine exchanger SteT OS=Bacillus subtilis (strain 168) GN=steT PE=1 SV=1 42 438 1.0E-15
sp|Q5RKI7|S7A13_RAT Solute carrier family 7 member 13 OS=Rattus norvegicus GN=Slc7a13 PE=2 SV=1 42 370 3.0E-15
sp|Q91WN3|S7A13_MOUSE Solute carrier family 7 member 13 OS=Mus musculus GN=Slc7a13 PE=1 SV=1 42 454 2.0E-14
sp|Q8TCU3|S7A13_HUMAN Solute carrier family 7 member 13 OS=Homo sapiens GN=SLC7A13 PE=2 SV=1 42 370 4.0E-13
sp|Q8MH63|LAT1N_HUMAN Putative L-type amino acid transporter 1-like protein MLAS OS=Homo sapiens GN=SLC7A5P1 PE=5 SV=1 42 119 7.0E-08
sp|Q8X845|FRLA_ECO57 Putative fructoselysine transporter FrlA OS=Escherichia coli O157:H7 GN=frlA PE=3 SV=2 38 369 3.0E-07
sp|P45539|FRLA_ECOLI Putative fructoselysine transporter FrlA OS=Escherichia coli (strain K12) GN=frlA PE=3 SV=2 38 369 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.5

Transmembrane Domains

Domain # Start End Length
1 45 67 22
2 77 99 22
3 129 151 22
4 166 187 21
5 194 213 19
6 228 250 22
7 271 293 22
8 321 340 19
9 365 387 22
10 397 419 22
11 431 453 22
12 468 490 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 371.47 162.46 580.48
CcL In ants, during behavior modification 7.67 2.77 12.57
CcD In ants, recently dead 6.64 2.25 11.04

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.702533 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5388
MERLVDGGREIGGGQGLGKGCDSVSTSVETELGRLELARENKRQIGIFSASLLIFNRTIGTAIFATPATILSLSG
SIGLSLMLWLTGMVIALAGTAVYMELGTGLPRNGGEKNYLEYVYRRPRLLTTSLYTGYVLLLGWAAGNSVIFGEY
ILHAARVETGRWNQRAIALGCLTAAFLIHGLALKWGIRVQNALGILKIGVILIIIIAPLFNLAKVRENTNFRGHI
FEGTTVSAYGIVTALYNVIWSFVGYSNANYALSETRNPTYTLKYAAPLGIGTISVLYILANVSYFAVVSKEDIID
SKRLVAASLFRNVFGEPAERALSVFVALSALGNVMSVIFSQGRLVQELGREGILPFSRLWASNRPFNAPLAGLFQ
HWLITSITVIAPPAGDAYNFVLNLISYPLAIINVFVAGALIHLYRNRDTWQWNPPLKATLPVVIFFLLSNIYLVV
APFVPPENDSQSIYDNLPYWIHCAVGFGVILAGGLYWLVWAVLMPKLGRYELVRETVVDSFDGWERTVFIKRPLA
VADHAAPQPRHE
Coding >Ophio5|5388
ATGGAGCGTCTTGTTGATGGTGGGCGAGAGATTGGCGGTGGGCAGGGTTTGGGAAAGGGTTGTGATTCGGTTTCG
ACGAGTGTTGAGACGGAGTTGGGCCGTCTTGAACTCGCGCGCGAAAACAAGCGTCAAATCGGCATCTTCTCCGCC
TCCCTCCTCATCTTCAACCGCACCATCGGCACCGCCATCTTCGCCACCCCAGCCACCATCCTCAGTCTCTCCGGC
AGTATCGGTCTATCGCTGATGCTCTGGCTGACGGGTATGGTCATCGCTCTCGCCGGCACCGCCGTGTACATGGAG
CTCGGCACCGGTCTTCCCCGGAATGGCGGCGAGAAGAATTATCTCGAGTATGTTTACCGTCGTCCGCGCCTCCTC
ACTACCAGTCTTTATACCGGCTATGTCTTGTTGCTCGGTTGGGCTGCGGGGAATTCCGTCATTTTTGGAGAGTAT
ATTCTTCATGCGGCTAGGGTTGAGACCGGGAGGTGGAATCAGCGGGCCATTGCGCTCGGTTGCCTCACTGCTGCC
TTTCTCATTCATGGCCTGGCTTTGAAATGGGGTATTCGCGTGCAGAATGCGCTGGGGATTCTCAAAATCGGCGTC
ATCCTCATCATCATCATCGCTCCGCTCTTCAACCTCGCCAAGGTCCGTGAGAATACAAACTTCAGGGGTCACATC
TTCGAAGGCACCACCGTCAGTGCCTATGGCATCGTCACCGCTCTCTACAACGTCATCTGGAGCTTCGTCGGCTAC
AGCAACGCCAATTACGCCCTCAGCGAGACGCGCAACCCGACTTACACGCTCAAGTACGCCGCCCCTCTGGGCATC
GGCACCATTTCCGTTCTCTACATTCTCGCCAACGTCTCCTACTTTGCCGTCGTCTCCAAGGAGGACATCATCGAC
TCAAAGCGTCTCGTTGCCGCTTCTCTTTTCCGAAACGTCTTCGGCGAACCTGCTGAGCGTGCCTTGTCCGTCTTC
GTCGCCCTTTCTGCGTTGGGAAATGTTATGAGCGTCATCTTCTCCCAAGGAAGGCTGGTGCAGGAGCTTGGCCGC
GAGGGGATTCTTCCCTTTTCGCGCCTTTGGGCCAGCAATCGCCCCTTTAACGCGCCGCTGGCTGGCCTCTTTCAG
CACTGGCTCATCACTTCCATCACCGTCATCGCCCCGCCCGCCGGCGACGCGTATAATTTCGTGTTGAACCTCATC
TCCTATCCCCTCGCCATCATCAATGTCTTCGTCGCCGGAGCGCTAATCCACCTCTACCGCAACCGCGACACTTGG
CAATGGAACCCGCCTCTAAAAGCCACTCTACCCGTCGTCATCTTCTTCCTCCTGAGCAACATCTACCTCGTCGTC
GCCCCCTTCGTGCCCCCGGAAAACGACAGCCAGAGCATCTATGACAACCTCCCCTACTGGATCCACTGCGCCGTC
GGCTTTGGAGTCATCCTTGCCGGCGGCCTGTACTGGCTCGTATGGGCTGTGCTGATGCCCAAACTTGGCCGCTAT
GAGCTGGTGCGAGAGACTGTAGTCGACAGCTTTGACGGCTGGGAGAGGACCGTTTTCATAAAGAGACCGCTCGCA
GTTGCAGACCACGCGGCCCCTCAACCTCGCCATGAA
Transcript >Ophio5|5388
ATGGAGCGTCTTGTTGATGGTGGGCGAGAGATTGGCGGTGGGCAGGGTTTGGGAAAGGGTTGTGATTCGGTTTCG
ACGAGTGTTGAGACGGAGTTGGGCCGTCTTGAACTCGCGCGCGAAAACAAGCGTCAAATCGGCATCTTCTCCGCC
TCCCTCCTCATCTTCAACCGCACCATCGGCACCGCCATCTTCGCCACCCCAGCCACCATCCTCAGTCTCTCCGGC
AGTATCGGTCTATCGCTGATGCTCTGGCTGACGGGTATGGTCATCGCTCTCGCCGGCACCGCCGTGTACATGGAG
CTCGGCACCGGTCTTCCCCGGAATGGCGGCGAGAAGAATTATCTCGAGTATGTTTACCGTCGTCCGCGCCTCCTC
ACTACCAGTCTTTATACCGGCTATGTCTTGTTGCTCGGTTGGGCTGCGGGGAATTCCGTCATTTTTGGAGAGTAT
ATTCTTCATGCGGCTAGGGTTGAGACCGGGAGGTGGAATCAGCGGGCCATTGCGCTCGGTTGCCTCACTGCTGCC
TTTCTCATTCATGGCCTGGCTTTGAAATGGGGTATTCGCGTGCAGAATGCGCTGGGGATTCTCAAAATCGGCGTC
ATCCTCATCATCATCATCGCTCCGCTCTTCAACCTCGCCAAGGTCCGTGAGAATACAAACTTCAGGGGTCACATC
TTCGAAGGCACCACCGTCAGTGCCTATGGCATCGTCACCGCTCTCTACAACGTCATCTGGAGCTTCGTCGGCTAC
AGCAACGCCAATTACGCCCTCAGCGAGACGCGCAACCCGACTTACACGCTCAAGTACGCCGCCCCTCTGGGCATC
GGCACCATTTCCGTTCTCTACATTCTCGCCAACGTCTCCTACTTTGCCGTCGTCTCCAAGGAGGACATCATCGAC
TCAAAGCGTCTCGTTGCCGCTTCTCTTTTCCGAAACGTCTTCGGCGAACCTGCTGAGCGTGCCTTGTCCGTCTTC
GTCGCCCTTTCTGCGTTGGGAAATGTTATGAGCGTCATCTTCTCCCAAGGAAGGCTGGTGCAGGAGCTTGGCCGC
GAGGGGATTCTTCCCTTTTCGCGCCTTTGGGCCAGCAATCGCCCCTTTAACGCGCCGCTGGCTGGCCTCTTTCAG
CACTGGCTCATCACTTCCATCACCGTCATCGCCCCGCCCGCCGGCGACGCGTATAATTTCGTGTTGAACCTCATC
TCCTATCCCCTCGCCATCATCAATGTCTTCGTCGCCGGAGCGCTAATCCACCTCTACCGCAACCGCGACACTTGG
CAATGGAACCCGCCTCTAAAAGCCACTCTACCCGTCGTCATCTTCTTCCTCCTGAGCAACATCTACCTCGTCGTC
GCCCCCTTCGTGCCCCCGGAAAACGACAGCCAGAGCATCTATGACAACCTCCCCTACTGGATCCACTGCGCCGTC
GGCTTTGGAGTCATCCTTGCCGGCGGCCTGTACTGGCTCGTATGGGCTGTGCTGATGCCCAAACTTGGCCGCTAT
GAGCTGGTGCGAGAGACTGTAGTCGACAGCTTTGACGGCTGGGAGAGGACCGTTTTCATAAAGAGACCGCTCGCA
GTTGCAGACCACGCGGCCCCTCAACCTCGCCATGAATGA
Gene >Ophio5|5388
ATGGAGCGTCTTGTTGATGGTGGGCGAGAGATTGGCGGTGGGCAGGGTTTGGGAAAGGGTTGTGATTCGGTTTCG
ACGAGTGTTGAGACGGAGTTGGGTTAGTTGATATCTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCC
CCCCCCTTTTCTTTTTGTCTTTCTTTCTCTTTCCTATCGTCGTTTTCATGGGAGATGGATCAAAGGCCACGGAAA
GAAACCCCCCCCCAAAAAAAAACAGATCTAACTAAACAAACAAGGCCGTCTTGAACTCGCGCGCGAAAACAAGCG
TCAAATCGGCATCTTCTCCGCCTCCCTCCTCATCTTCAACCGCACCATCGGCACCGCCATCTTCGCCACCCCAGC
CACCATCCTCAGTCTCTCCGGCAGTATCGGTCTATCGCTGATGCTCTGGCTGACGGGTATGGTCATCGCTCTCGC
CGGCACCGCCGTGTACATGGAGCTCGGCACCGGTCTTCCCCGGAATGGCGGCGAGAAGAATTATCTCGAGTATGT
TTACCGTCGTCCGCGCCTCCTCACTACCAGTCTTTATACCGGCTATGTCTTGTTGCTCGGTTGGGCTGCGGGGAA
TTCCGTCATTTTTGGAGAGTATATTCTTCATGCGGCTAGGGTTGAGACCGGGAGGTGGAATCAGCGGGCCATTGC
GCTCGGTTGCCTCACTGCTGCCTTTCTCATTCATGGCCTGGCTTTGAAATGGGGTATTCGCGTGCAGAATGCGCT
GGGGATTCTCAAAATCGGCGTCATCCTCATCATCATCATCGCTCCGCTCTTCAACCTCGCCAAGGTCCGTGAGAA
TACAAACTTCAGGGGTCACATCTTCGAAGGCACCACCGTCAGTGCCTATGGCATCGTCACCGCTCTCTACAACGT
CATCTGGAGCTTCGTCGGCTACAGCAACGCCAATTACGCCCTCAGCGAGACGCGCAACCCGACTTACACGCTCAA
GTACGCCGCCCCTCTGGGCATCGGCACCATTTCCGTTCTCTACATTCTCGCCAACGTCTCCTACTTTGCCGTCGT
CTCCAAGGAGGACATCATCGACTCAAAGCGTCTCGTTGCCGCTTCTCTTTTCCGAAACGTCTTCGGCGAACCTGC
TGAGCGTGCCTTGTCCGTCTTCGTCGCCCTTTCTGCGTTGGGAAATGTTATGAGCGTCATCTTCTCCCAAGGAAG
GCTGGTGCAGGAGCTTGGCCGCGAGGGGATTCTTCCCTTTTCGCGCCTTTGGGCCAGCAATCGCCCCTTTAACGC
GCCGCTGGCTGGCCTCTTTCAGCACTGGCTCATCACTTCCATCACCGTCATCGCCCCGCCCGCCGGCGACGCGTA
TAATTTCGTGTTGAAGTGAGTTGCATTGGGGACCCCTGTTTGATATCCTCAGAGACTAACGCTCCCTCTTAGCCT
CATCTCCTATCCCCTCGCCATCATCAATGTCTTCGTCGCCGGAGCGCTAATCCACCTCTACCGCAACCGCGACAC
TTGGCAATGGAACCCGCCTCTAAAAGCCACTCTACCCGTCGTCATCTTCTTCCTCCTGAGCAACATCTACCTCGT
CGTCGCCCCCTTCGTGCCCCCGGAAAACGACAGCCAGAGCATCTATGACAACCTCCCCTACTGGATCCACTGCGC
CGTCGGCTTTGGAGTCATCCTTGCCGGCGGCCTGTACTGGCTCGTATGGGCTGTGCTGATGCCCAAACTTGGCCG
CTATGAGCTGGTGCGAGAGACTGTAGTCGACAGCTTTGACGGCTGGGAGAGGACCGTTTTCATAAAGAGACCGCT
CGCAGTTGCAGACCACGCGGCCCCTCAACCTCGCCATGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail