Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5388
Gene name
Locationscaffold_44:8528..10371
Strand+
Gene length (bp)1843
Transcript length (bp)1614
Coding sequence length (bp)1611
Protein length (aa) 537

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 1.4E-85 45 476
PF00324 AA_permease Amino acid permease 2.3E-15 58 487

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50276|MUP1_YEAST High-affinity methionine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MUP1 PE=1 SV=1 40 521 2.0E-168
sp|P38734|MUP3_YEAST Low-affinity methionine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MUP3 PE=1 SV=1 20 523 8.0E-68
sp|P82251|BAT1_HUMAN b(0,+)-type amino acid transporter 1 OS=Homo sapiens GN=SLC7A9 PE=1 SV=1 42 454 2.0E-34
sp|Q9N1R6|BAT1_RABIT b(0,+)-type amino acid transporter 1 OS=Oryctolagus cuniculus GN=SLC7A9 PE=1 SV=1 42 454 5.0E-34
sp|Q9WTR6|XCT_MOUSE Cystine/glutamate transporter OS=Mus musculus GN=Slc7a11 PE=1 SV=1 42 450 8.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50276|MUP1_YEAST High-affinity methionine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MUP1 PE=1 SV=1 40 521 2.0E-168
sp|P38734|MUP3_YEAST Low-affinity methionine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MUP3 PE=1 SV=1 20 523 8.0E-68
sp|P82251|BAT1_HUMAN b(0,+)-type amino acid transporter 1 OS=Homo sapiens GN=SLC7A9 PE=1 SV=1 42 454 2.0E-34
sp|Q9N1R6|BAT1_RABIT b(0,+)-type amino acid transporter 1 OS=Oryctolagus cuniculus GN=SLC7A9 PE=1 SV=1 42 454 5.0E-34
sp|Q9WTR6|XCT_MOUSE Cystine/glutamate transporter OS=Mus musculus GN=Slc7a11 PE=1 SV=1 42 450 8.0E-34
sp|Q9QXA6|BAT1_MOUSE b(0,+)-type amino acid transporter 1 OS=Mus musculus GN=Slc7a9 PE=1 SV=1 22 352 8.0E-33
sp|P82252|BAT1_RAT b(0,+)-type amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a9 PE=1 SV=1 42 352 3.0E-31
sp|Q9Z1K8|YLAT1_MOUSE Y+L amino acid transporter 1 OS=Mus musculus GN=Slc7a7 PE=1 SV=1 5 507 8.0E-31
sp|Q9R0S5|YLAT1_RAT Y+L amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a7 PE=1 SV=1 42 510 2.0E-30
sp|Q92536|YLAT2_HUMAN Y+L amino acid transporter 2 OS=Homo sapiens GN=SLC7A6 PE=1 SV=3 22 537 9.0E-30
sp|Q59I64|YLAT2_DANRE Y+L amino acid transporter 2 OS=Danio rerio GN=slc7a6 PE=2 SV=1 42 452 1.0E-29
sp|Q8BGK6|YLAT2_MOUSE Y+L amino acid transporter 2 OS=Mus musculus GN=Slc7a6 PE=1 SV=1 42 507 2.0E-29
sp|Q9UM01|YLAT1_HUMAN Y+L amino acid transporter 1 OS=Homo sapiens GN=SLC7A7 PE=1 SV=2 42 452 1.0E-27
sp|A1L3M3|YLAT2_XENLA Y+L amino acid transporter 2 OS=Xenopus laevis GN=slc7a6 PE=2 SV=1 22 519 9.0E-27
sp|Q9UPY5|XCT_HUMAN Cystine/glutamate transporter OS=Homo sapiens GN=SLC7A11 PE=1 SV=1 66 449 6.0E-26
sp|Q5RAG7|XCT_PONAB Cystine/glutamate transporter OS=Pongo abelii GN=SLC7A11 PE=2 SV=1 66 449 7.0E-26
sp|Q28I80|YLAT2_XENTR Y+L amino acid transporter 2 OS=Xenopus tropicalis GN=slc7a6 PE=2 SV=1 42 452 6.0E-25
sp|Q01650|LAT1_HUMAN Large neutral amino acids transporter small subunit 1 OS=Homo sapiens GN=SLC7A5 PE=1 SV=2 42 487 3.0E-24
sp|Q7YQK4|LAT1_RABIT Large neutral amino acids transporter small subunit 1 OS=Oryctolagus cuniculus GN=SLC7A5 PE=1 SV=1 42 487 1.0E-22
sp|Q9QXW9|LAT2_MOUSE Large neutral amino acids transporter small subunit 2 OS=Mus musculus GN=Slc7a8 PE=1 SV=1 42 487 1.0E-21
sp|Q9WVR6|LAT2_RAT Large neutral amino acids transporter small subunit 2 OS=Rattus norvegicus GN=Slc7a8 PE=1 SV=1 42 487 1.0E-21
sp|Q9UHI5|LAT2_HUMAN Large neutral amino acids transporter small subunit 2 OS=Homo sapiens GN=SLC7A8 PE=1 SV=1 42 487 2.0E-21
sp|Q5RAE3|LAT2_PONAB Large neutral amino acids transporter small subunit 2 OS=Pongo abelii GN=SLC7A8 PE=2 SV=2 42 487 2.0E-21
sp|Q9Z127|LAT1_MOUSE Large neutral amino acids transporter small subunit 1 OS=Mus musculus GN=Slc7a5 PE=1 SV=2 42 487 5.0E-21
sp|Q63016|LAT1_RAT Large neutral amino acids transporter small subunit 1 OS=Rattus norvegicus GN=Slc7a5 PE=1 SV=2 42 487 8.0E-21
sp|Q9N1Q4|LAT2_RABIT Large neutral amino acids transporter small subunit 2 OS=Oryctolagus cuniculus GN=SLC7A8 PE=1 SV=1 42 487 5.0E-20
sp|P63115|AAA1_MOUSE Asc-type amino acid transporter 1 OS=Mus musculus GN=Slc7a10 PE=1 SV=1 42 487 8.0E-19
sp|P63116|AAA1_RAT Asc-type amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a10 PE=2 SV=1 42 487 8.0E-19
sp|Q9NS82|AAA1_HUMAN Asc-type amino acid transporter 1 OS=Homo sapiens GN=SLC7A10 PE=2 SV=1 15 402 5.0E-18
sp|O34739|STET_BACSU Serine/threonine exchanger SteT OS=Bacillus subtilis (strain 168) GN=steT PE=1 SV=1 42 438 1.0E-15
sp|Q5RKI7|S7A13_RAT Solute carrier family 7 member 13 OS=Rattus norvegicus GN=Slc7a13 PE=2 SV=1 42 370 3.0E-15
sp|Q91WN3|S7A13_MOUSE Solute carrier family 7 member 13 OS=Mus musculus GN=Slc7a13 PE=1 SV=1 42 454 2.0E-14
sp|Q8TCU3|S7A13_HUMAN Solute carrier family 7 member 13 OS=Homo sapiens GN=SLC7A13 PE=2 SV=1 42 370 4.0E-13
sp|Q8MH63|LAT1N_HUMAN Putative L-type amino acid transporter 1-like protein MLAS OS=Homo sapiens GN=SLC7A5P1 PE=5 SV=1 42 119 7.0E-08
sp|Q8X845|FRLA_ECO57 Putative fructoselysine transporter FrlA OS=Escherichia coli O157:H7 GN=frlA PE=3 SV=2 38 369 3.0E-07
sp|P45539|FRLA_ECOLI Putative fructoselysine transporter FrlA OS=Escherichia coli (strain K12) GN=frlA PE=3 SV=2 38 369 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.5

Transmembrane Domains

Domain # Start End Length
1 45 67 22
2 77 99 22
3 129 151 22
4 166 187 21
5 194 213 19
6 228 250 22
7 271 293 22
8 321 340 19
9 365 387 22
10 397 419 22
11 431 453 22
12 468 490 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5388
MERLVDGGREIGGGQGLGKGCDSVSTSVETELGRLELARENKRQIGIFSASLLIFNRTIGTAIFATPATILSLSG
SIGLSLMLWLTGMVIALAGTAVYMELGTGLPRNGGEKNYLEYVYRRPRLLTTSLYTGYVLLLGWAAGNSVIFGEY
ILHAARVETGRWNQRAIALGCLTAAFLIHGLALKWGIRVQNALGILKIGVILIIIIAPLFNLAKVRENTNFRGHI
FEGTTVSAYGIVTALYNVIWSFVGYSNANYALSETRNPTYTLKYAAPLGIGTISVLYILANVSYFAVVSKEDIID
SKRLVAASLFRNVFGEPAERALSVFVALSALGNVMSVIFSQGRLVQELGREGILPFSRLWASNRPFNAPLAGLFQ
HWLITSITVIAPPAGDAYNFVLNLISYPLAIINVFVAGALIHLYRNRDTWQWNPPLKATLPVVIFFLLSNIYLVV
APFVPPENDSQSIYDNLPYWIHCAVGFGVILAGGLYWLVWAVLMPKLGRYELVRETVVDSFDGWERTVFIKRPLA
VADHAAPQPRHE
Coding >Ophio5|5388
ATGGAGCGTCTTGTTGATGGTGGGCGAGAGATTGGCGGTGGGCAGGGTTTGGGAAAGGGTTGTGATTCGGTTTCG
ACGAGTGTTGAGACGGAGTTGGGCCGTCTTGAACTCGCGCGCGAAAACAAGCGTCAAATCGGCATCTTCTCCGCC
TCCCTCCTCATCTTCAACCGCACCATCGGCACCGCCATCTTCGCCACCCCAGCCACCATCCTCAGTCTCTCCGGC
AGTATCGGTCTATCGCTGATGCTCTGGCTGACGGGTATGGTCATCGCTCTCGCCGGCACCGCCGTGTACATGGAG
CTCGGCACCGGTCTTCCCCGGAATGGCGGCGAGAAGAATTATCTCGAGTATGTTTACCGTCGTCCGCGCCTCCTC
ACTACCAGTCTTTATACCGGCTATGTCTTGTTGCTCGGTTGGGCTGCGGGGAATTCCGTCATTTTTGGAGAGTAT
ATTCTTCATGCGGCTAGGGTTGAGACCGGGAGGTGGAATCAGCGGGCCATTGCGCTCGGTTGCCTCACTGCTGCC
TTTCTCATTCATGGCCTGGCTTTGAAATGGGGTATTCGCGTGCAGAATGCGCTGGGGATTCTCAAAATCGGCGTC
ATCCTCATCATCATCATCGCTCCGCTCTTCAACCTCGCCAAGGTCCGTGAGAATACAAACTTCAGGGGTCACATC
TTCGAAGGCACCACCGTCAGTGCCTATGGCATCGTCACCGCTCTCTACAACGTCATCTGGAGCTTCGTCGGCTAC
AGCAACGCCAATTACGCCCTCAGCGAGACGCGCAACCCGACTTACACGCTCAAGTACGCCGCCCCTCTGGGCATC
GGCACCATTTCCGTTCTCTACATTCTCGCCAACGTCTCCTACTTTGCCGTCGTCTCCAAGGAGGACATCATCGAC
TCAAAGCGTCTCGTTGCCGCTTCTCTTTTCCGAAACGTCTTCGGCGAACCTGCTGAGCGTGCCTTGTCCGTCTTC
GTCGCCCTTTCTGCGTTGGGAAATGTTATGAGCGTCATCTTCTCCCAAGGAAGGCTGGTGCAGGAGCTTGGCCGC
GAGGGGATTCTTCCCTTTTCGCGCCTTTGGGCCAGCAATCGCCCCTTTAACGCGCCGCTGGCTGGCCTCTTTCAG
CACTGGCTCATCACTTCCATCACCGTCATCGCCCCGCCCGCCGGCGACGCGTATAATTTCGTGTTGAACCTCATC
TCCTATCCCCTCGCCATCATCAATGTCTTCGTCGCCGGAGCGCTAATCCACCTCTACCGCAACCGCGACACTTGG
CAATGGAACCCGCCTCTAAAAGCCACTCTACCCGTCGTCATCTTCTTCCTCCTGAGCAACATCTACCTCGTCGTC
GCCCCCTTCGTGCCCCCGGAAAACGACAGCCAGAGCATCTATGACAACCTCCCCTACTGGATCCACTGCGCCGTC
GGCTTTGGAGTCATCCTTGCCGGCGGCCTGTACTGGCTCGTATGGGCTGTGCTGATGCCCAAACTTGGCCGCTAT
GAGCTGGTGCGAGAGACTGTAGTCGACAGCTTTGACGGCTGGGAGAGGACCGTTTTCATAAAGAGACCGCTCGCA
GTTGCAGACCACGCGGCCCCTCAACCTCGCCATGAA
Transcript >Ophio5|5388
ATGGAGCGTCTTGTTGATGGTGGGCGAGAGATTGGCGGTGGGCAGGGTTTGGGAAAGGGTTGTGATTCGGTTTCG
ACGAGTGTTGAGACGGAGTTGGGCCGTCTTGAACTCGCGCGCGAAAACAAGCGTCAAATCGGCATCTTCTCCGCC
TCCCTCCTCATCTTCAACCGCACCATCGGCACCGCCATCTTCGCCACCCCAGCCACCATCCTCAGTCTCTCCGGC
AGTATCGGTCTATCGCTGATGCTCTGGCTGACGGGTATGGTCATCGCTCTCGCCGGCACCGCCGTGTACATGGAG
CTCGGCACCGGTCTTCCCCGGAATGGCGGCGAGAAGAATTATCTCGAGTATGTTTACCGTCGTCCGCGCCTCCTC
ACTACCAGTCTTTATACCGGCTATGTCTTGTTGCTCGGTTGGGCTGCGGGGAATTCCGTCATTTTTGGAGAGTAT
ATTCTTCATGCGGCTAGGGTTGAGACCGGGAGGTGGAATCAGCGGGCCATTGCGCTCGGTTGCCTCACTGCTGCC
TTTCTCATTCATGGCCTGGCTTTGAAATGGGGTATTCGCGTGCAGAATGCGCTGGGGATTCTCAAAATCGGCGTC
ATCCTCATCATCATCATCGCTCCGCTCTTCAACCTCGCCAAGGTCCGTGAGAATACAAACTTCAGGGGTCACATC
TTCGAAGGCACCACCGTCAGTGCCTATGGCATCGTCACCGCTCTCTACAACGTCATCTGGAGCTTCGTCGGCTAC
AGCAACGCCAATTACGCCCTCAGCGAGACGCGCAACCCGACTTACACGCTCAAGTACGCCGCCCCTCTGGGCATC
GGCACCATTTCCGTTCTCTACATTCTCGCCAACGTCTCCTACTTTGCCGTCGTCTCCAAGGAGGACATCATCGAC
TCAAAGCGTCTCGTTGCCGCTTCTCTTTTCCGAAACGTCTTCGGCGAACCTGCTGAGCGTGCCTTGTCCGTCTTC
GTCGCCCTTTCTGCGTTGGGAAATGTTATGAGCGTCATCTTCTCCCAAGGAAGGCTGGTGCAGGAGCTTGGCCGC
GAGGGGATTCTTCCCTTTTCGCGCCTTTGGGCCAGCAATCGCCCCTTTAACGCGCCGCTGGCTGGCCTCTTTCAG
CACTGGCTCATCACTTCCATCACCGTCATCGCCCCGCCCGCCGGCGACGCGTATAATTTCGTGTTGAACCTCATC
TCCTATCCCCTCGCCATCATCAATGTCTTCGTCGCCGGAGCGCTAATCCACCTCTACCGCAACCGCGACACTTGG
CAATGGAACCCGCCTCTAAAAGCCACTCTACCCGTCGTCATCTTCTTCCTCCTGAGCAACATCTACCTCGTCGTC
GCCCCCTTCGTGCCCCCGGAAAACGACAGCCAGAGCATCTATGACAACCTCCCCTACTGGATCCACTGCGCCGTC
GGCTTTGGAGTCATCCTTGCCGGCGGCCTGTACTGGCTCGTATGGGCTGTGCTGATGCCCAAACTTGGCCGCTAT
GAGCTGGTGCGAGAGACTGTAGTCGACAGCTTTGACGGCTGGGAGAGGACCGTTTTCATAAAGAGACCGCTCGCA
GTTGCAGACCACGCGGCCCCTCAACCTCGCCATGAATGA
Gene >Ophio5|5388
ATGGAGCGTCTTGTTGATGGTGGGCGAGAGATTGGCGGTGGGCAGGGTTTGGGAAAGGGTTGTGATTCGGTTTCG
ACGAGTGTTGAGACGGAGTTGGGTTAGTTGATATCTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCC
CCCCCCTTTTCTTTTTGTCTTTCTTTCTCTTTCCTATCGTCGTTTTCATGGGAGATGGATCAAAGGCCACGGAAA
GAAACCCCCCCCCAAAAAAAAACAGATCTAACTAAACAAACAAGGCCGTCTTGAACTCGCGCGCGAAAACAAGCG
TCAAATCGGCATCTTCTCCGCCTCCCTCCTCATCTTCAACCGCACCATCGGCACCGCCATCTTCGCCACCCCAGC
CACCATCCTCAGTCTCTCCGGCAGTATCGGTCTATCGCTGATGCTCTGGCTGACGGGTATGGTCATCGCTCTCGC
CGGCACCGCCGTGTACATGGAGCTCGGCACCGGTCTTCCCCGGAATGGCGGCGAGAAGAATTATCTCGAGTATGT
TTACCGTCGTCCGCGCCTCCTCACTACCAGTCTTTATACCGGCTATGTCTTGTTGCTCGGTTGGGCTGCGGGGAA
TTCCGTCATTTTTGGAGAGTATATTCTTCATGCGGCTAGGGTTGAGACCGGGAGGTGGAATCAGCGGGCCATTGC
GCTCGGTTGCCTCACTGCTGCCTTTCTCATTCATGGCCTGGCTTTGAAATGGGGTATTCGCGTGCAGAATGCGCT
GGGGATTCTCAAAATCGGCGTCATCCTCATCATCATCATCGCTCCGCTCTTCAACCTCGCCAAGGTCCGTGAGAA
TACAAACTTCAGGGGTCACATCTTCGAAGGCACCACCGTCAGTGCCTATGGCATCGTCACCGCTCTCTACAACGT
CATCTGGAGCTTCGTCGGCTACAGCAACGCCAATTACGCCCTCAGCGAGACGCGCAACCCGACTTACACGCTCAA
GTACGCCGCCCCTCTGGGCATCGGCACCATTTCCGTTCTCTACATTCTCGCCAACGTCTCCTACTTTGCCGTCGT
CTCCAAGGAGGACATCATCGACTCAAAGCGTCTCGTTGCCGCTTCTCTTTTCCGAAACGTCTTCGGCGAACCTGC
TGAGCGTGCCTTGTCCGTCTTCGTCGCCCTTTCTGCGTTGGGAAATGTTATGAGCGTCATCTTCTCCCAAGGAAG
GCTGGTGCAGGAGCTTGGCCGCGAGGGGATTCTTCCCTTTTCGCGCCTTTGGGCCAGCAATCGCCCCTTTAACGC
GCCGCTGGCTGGCCTCTTTCAGCACTGGCTCATCACTTCCATCACCGTCATCGCCCCGCCCGCCGGCGACGCGTA
TAATTTCGTGTTGAAGTGAGTTGCATTGGGGACCCCTGTTTGATATCCTCAGAGACTAACGCTCCCTCTTAGCCT
CATCTCCTATCCCCTCGCCATCATCAATGTCTTCGTCGCCGGAGCGCTAATCCACCTCTACCGCAACCGCGACAC
TTGGCAATGGAACCCGCCTCTAAAAGCCACTCTACCCGTCGTCATCTTCTTCCTCCTGAGCAACATCTACCTCGT
CGTCGCCCCCTTCGTGCCCCCGGAAAACGACAGCCAGAGCATCTATGACAACCTCCCCTACTGGATCCACTGCGC
CGTCGGCTTTGGAGTCATCCTTGCCGGCGGCCTGTACTGGCTCGTATGGGCTGTGCTGATGCCCAAACTTGGCCG
CTATGAGCTGGTGCGAGAGACTGTAGTCGACAGCTTTGACGGCTGGGAGAGGACCGTTTTCATAAAGAGACCGCT
CGCAGTTGCAGACCACGCGGCCCCTCAACCTCGCCATGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail