Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5377
Gene name
Locationscaffold_439:5623..7369
Strand-
Gene length (bp)1746
Transcript length (bp)1746
Coding sequence length (bp)1743
Protein length (aa) 581

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.2E-15 61 509

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IM48|MCH1_GIBZE Probable transporter MCH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MCH1 PE=3 SV=1 33 581 0.0E+00
sp|Q9P3K8|MCH1_NEUCR Probable transporter mch1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mch1 PE=3 SV=1 39 581 0.0E+00
sp|Q5AXV1|MCH1_EMENI Probable transporter mch1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mch1 PE=3 SV=2 40 581 5.0E-130
sp|Q4WVT3|MCH1_ASPFU Probable transporter mch1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mch1 PE=3 SV=1 40 581 3.0E-128
sp|Q96TW9|MCH1_WICAO Probable transporter MCH1 OS=Wickerhamomyces anomalus GN=MCH1 PE=3 SV=1 42 554 5.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IM48|MCH1_GIBZE Probable transporter MCH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MCH1 PE=3 SV=1 33 581 0.0E+00
sp|Q9P3K8|MCH1_NEUCR Probable transporter mch1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mch1 PE=3 SV=1 39 581 0.0E+00
sp|Q5AXV1|MCH1_EMENI Probable transporter mch1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mch1 PE=3 SV=2 40 581 5.0E-130
sp|Q4WVT3|MCH1_ASPFU Probable transporter mch1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mch1 PE=3 SV=1 40 581 3.0E-128
sp|Q96TW9|MCH1_WICAO Probable transporter MCH1 OS=Wickerhamomyces anomalus GN=MCH1 PE=3 SV=1 42 554 5.0E-52
sp|Q6CGU8|MCH1_YARLI Probable transporter MCH1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MCH1 PE=3 SV=1 25 579 3.0E-40
sp|Q6BN11|MCH1_DEBHA Probable transporter MCH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MCH1 PE=3 SV=2 50 578 5.0E-32
sp|Q07376|MCH1_YEAST Probable transporter MCH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH1 PE=1 SV=1 53 520 4.0E-29
sp|Q6FWD4|MCH1_CANGA Probable transporter MCH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MCH1 PE=3 SV=1 53 520 2.0E-26
sp|Q59MJ2|MCH1_CANAL Probable transporter MCH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MCH1 PE=3 SV=1 48 578 2.0E-21
sp|Q6CPY8|MCH1_KLULA Probable transporter MCH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MCH1 PE=3 SV=1 62 523 4.0E-18
sp|Q752I1|MCH1_ASHGO Probable transporter MCH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MCH1 PE=3 SV=1 56 526 4.0E-16
sp|Q03795|YM30_YEAST Uncharacterized membrane protein YMR155W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR155W PE=1 SV=1 52 556 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 52 74 22
2 89 111 22
3 116 138 22
4 161 183 22
5 196 218 22
6 238 260 22
7 339 361 22
8 376 395 19
9 432 454 22
10 467 489 22
11 496 518 22
12 549 568 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5377
MPESSRRRPVFVVEPPVEDGCLSPSPLQSPSAEDDYGDAERARRSGREAIKMVSLVSATLVALCAGSIAAFSLFA
PQFQSRLHYTQFQVNGVAIGSSLALYLPISIMGYVCDRVGVAPLAILSSILFGSGYGLAAAVFHKLDLDYNFHGK
PYGHHTGWSYPLMVFAFVCVGSGTCAMYIACVSTCAKNFGTGKHRGLALAMPVTGFGLSGMWLSQLGSRFLYETK
PDGSKGDVDVYRFLVFLAILLFIMGIIGTFTLRVVGEHDLIEEAIEELEHSGLLDQSSLLTRSERGFGTTGPSLA
AESDPLLDSSNGGDAKWKKNWVLNAETRRFLTDNTMWPFAIAFFLMIGPGEAFVNNLGTVIGTLTPPQMAGQHTS
VATHVSIFGVTSTVARLLIGTVTDLVAPSPETQHVQIGPSRGLRRSSPLKRLTISRVVFMLFFGVVMSIGFIFLA
SGAAQDHSERFWVVSGLVGAGYGAAFSLTPLIVTIIWGVENFATNFGIVAMLPALGSTFWGLVYSGVYQAGAKVP
GSKDSGDTYDDANLCYGMQCYSSVYWAEGLCVWLACAMLYWAWQGKNGWHHRGIVI
Coding >Ophio5|5377
ATGCCCGAATCGTCTCGCCGCCGTCCAGTCTTCGTCGTTGAACCGCCTGTGGAAGACGGCTGCTTGTCGCCATCT
CCGCTCCAGAGCCCCAGCGCCGAGGACGATTATGGCGATGCAGAGCGGGCGCGACGTTCCGGCAGAGAGGCCATT
AAGATGGTCTCTCTCGTCTCGGCAACCCTCGTCGCCCTCTGCGCCGGCTCTATCGCCGCCTTCTCTCTCTTCGCA
CCTCAGTTCCAGTCGCGGCTGCATTACACGCAGTTCCAGGTTAATGGCGTCGCTATAGGCAGCTCACTCGCTCTC
TATCTGCCCATCTCCATTATGGGATACGTCTGCGATCGCGTCGGTGTCGCCCCTCTTGCAATCCTCTCATCGATT
CTCTTCGGCAGTGGCTACGGCCTCGCTGCCGCCGTCTTCCACAAGCTCGACCTCGACTACAACTTCCACGGCAAG
CCTTACGGCCATCACACCGGCTGGTCGTACCCGCTCATGGTCTTCGCCTTTGTCTGCGTCGGATCAGGCACCTGC
GCCATGTACATTGCCTGCGTCTCGACTTGCGCCAAGAACTTTGGCACCGGCAAGCATCGCGGCCTTGCTCTGGCT
ATGCCCGTCACCGGTTTCGGCCTAAGCGGCATGTGGCTTAGCCAGTTGGGCAGTCGCTTCCTCTACGAGACGAAG
CCTGACGGCTCCAAAGGCGATGTCGACGTCTATCGTTTCCTTGTTTTCCTCGCCATTCTTCTCTTCATCATGGGC
ATCATCGGCACCTTCACACTGCGTGTCGTCGGCGAGCATGACTTGATCGAGGAGGCCATCGAGGAGCTCGAGCAC
AGCGGCCTCTTGGACCAAAGCTCCCTGCTTACCAGGTCCGAGAGGGGCTTTGGCACGACTGGTCCGAGCCTTGCC
GCTGAGAGCGACCCGCTCTTGGACTCGTCCAACGGCGGCGATGCCAAGTGGAAGAAGAACTGGGTTCTCAACGCC
GAAACCCGCCGGTTCCTCACCGACAACACCATGTGGCCCTTCGCCATTGCCTTTTTTCTCATGATCGGACCCGGC
GAGGCATTTGTCAACAACCTGGGAACCGTCATCGGCACCCTGACACCTCCGCAAATGGCCGGTCAGCACACGTCG
GTGGCAACCCACGTCTCTATTTTCGGCGTCACCAGCACTGTCGCCCGCCTGCTGATCGGTACCGTTACCGACCTA
GTGGCCCCGTCCCCTGAAACTCAACACGTTCAGATCGGCCCGAGTCGCGGCCTTCGCCGGTCTTCACCGTTGAAG
CGCCTGACCATCTCTCGTGTCGTCTTCATGCTTTTCTTCGGAGTCGTCATGTCTATCGGCTTCATCTTCCTCGCC
TCTGGTGCGGCCCAGGATCACTCCGAACGCTTCTGGGTTGTCTCGGGTCTGGTAGGGGCTGGCTACGGCGCCGCT
TTTAGTTTGACGCCGCTCATCGTCACCATCATCTGGGGTGTCGAGAACTTTGCGACCAACTTTGGCATCGTCGCC
ATGCTGCCAGCCTTGGGTTCTACCTTTTGGGGTCTGGTCTACTCTGGAGTTTACCAGGCCGGGGCCAAGGTACCG
GGCTCCAAGGATTCGGGGGATACTTACGATGACGCAAATCTCTGCTACGGCATGCAGTGTTACTCGTCGGTGTAT
TGGGCCGAGGGGCTCTGTGTCTGGTTGGCCTGCGCGATGCTCTACTGGGCCTGGCAAGGCAAAAATGGATGGCAT
CATCGTGGCATTGTCATA
Transcript >Ophio5|5377
ATGCCCGAATCGTCTCGCCGCCGTCCAGTCTTCGTCGTTGAACCGCCTGTGGAAGACGGCTGCTTGTCGCCATCT
CCGCTCCAGAGCCCCAGCGCCGAGGACGATTATGGCGATGCAGAGCGGGCGCGACGTTCCGGCAGAGAGGCCATT
AAGATGGTCTCTCTCGTCTCGGCAACCCTCGTCGCCCTCTGCGCCGGCTCTATCGCCGCCTTCTCTCTCTTCGCA
CCTCAGTTCCAGTCGCGGCTGCATTACACGCAGTTCCAGGTTAATGGCGTCGCTATAGGCAGCTCACTCGCTCTC
TATCTGCCCATCTCCATTATGGGATACGTCTGCGATCGCGTCGGTGTCGCCCCTCTTGCAATCCTCTCATCGATT
CTCTTCGGCAGTGGCTACGGCCTCGCTGCCGCCGTCTTCCACAAGCTCGACCTCGACTACAACTTCCACGGCAAG
CCTTACGGCCATCACACCGGCTGGTCGTACCCGCTCATGGTCTTCGCCTTTGTCTGCGTCGGATCAGGCACCTGC
GCCATGTACATTGCCTGCGTCTCGACTTGCGCCAAGAACTTTGGCACCGGCAAGCATCGCGGCCTTGCTCTGGCT
ATGCCCGTCACCGGTTTCGGCCTAAGCGGCATGTGGCTTAGCCAGTTGGGCAGTCGCTTCCTCTACGAGACGAAG
CCTGACGGCTCCAAAGGCGATGTCGACGTCTATCGTTTCCTTGTTTTCCTCGCCATTCTTCTCTTCATCATGGGC
ATCATCGGCACCTTCACACTGCGTGTCGTCGGCGAGCATGACTTGATCGAGGAGGCCATCGAGGAGCTCGAGCAC
AGCGGCCTCTTGGACCAAAGCTCCCTGCTTACCAGGTCCGAGAGGGGCTTTGGCACGACTGGTCCGAGCCTTGCC
GCTGAGAGCGACCCGCTCTTGGACTCGTCCAACGGCGGCGATGCCAAGTGGAAGAAGAACTGGGTTCTCAACGCC
GAAACCCGCCGGTTCCTCACCGACAACACCATGTGGCCCTTCGCCATTGCCTTTTTTCTCATGATCGGACCCGGC
GAGGCATTTGTCAACAACCTGGGAACCGTCATCGGCACCCTGACACCTCCGCAAATGGCCGGTCAGCACACGTCG
GTGGCAACCCACGTCTCTATTTTCGGCGTCACCAGCACTGTCGCCCGCCTGCTGATCGGTACCGTTACCGACCTA
GTGGCCCCGTCCCCTGAAACTCAACACGTTCAGATCGGCCCGAGTCGCGGCCTTCGCCGGTCTTCACCGTTGAAG
CGCCTGACCATCTCTCGTGTCGTCTTCATGCTTTTCTTCGGAGTCGTCATGTCTATCGGCTTCATCTTCCTCGCC
TCTGGTGCGGCCCAGGATCACTCCGAACGCTTCTGGGTTGTCTCGGGTCTGGTAGGGGCTGGCTACGGCGCCGCT
TTTAGTTTGACGCCGCTCATCGTCACCATCATCTGGGGTGTCGAGAACTTTGCGACCAACTTTGGCATCGTCGCC
ATGCTGCCAGCCTTGGGTTCTACCTTTTGGGGTCTGGTCTACTCTGGAGTTTACCAGGCCGGGGCCAAGGTACCG
GGCTCCAAGGATTCGGGGGATACTTACGATGACGCAAATCTCTGCTACGGCATGCAGTGTTACTCGTCGGTGTAT
TGGGCCGAGGGGCTCTGTGTCTGGTTGGCCTGCGCGATGCTCTACTGGGCCTGGCAAGGCAAAAATGGATGGCAT
CATCGTGGCATTGTCATATAG
Gene >Ophio5|5377
ATGCCCGAATCGTCTCGCCGCCGTCCAGTCTTCGTCGTTGAACCGCCTGTGGAAGACGGCTGCTTGTCGCCATCT
CCGCTCCAGAGCCCCAGCGCCGAGGACGATTATGGCGATGCAGAGCGGGCGCGACGTTCCGGCAGAGAGGCCATT
AAGATGGTCTCTCTCGTCTCGGCAACCCTCGTCGCCCTCTGCGCCGGCTCTATCGCCGCCTTCTCTCTCTTCGCA
CCTCAGTTCCAGTCGCGGCTGCATTACACGCAGTTCCAGGTTAATGGCGTCGCTATAGGCAGCTCACTCGCTCTC
TATCTGCCCATCTCCATTATGGGATACGTCTGCGATCGCGTCGGTGTCGCCCCTCTTGCAATCCTCTCATCGATT
CTCTTCGGCAGTGGCTACGGCCTCGCTGCCGCCGTCTTCCACAAGCTCGACCTCGACTACAACTTCCACGGCAAG
CCTTACGGCCATCACACCGGCTGGTCGTACCCGCTCATGGTCTTCGCCTTTGTCTGCGTCGGATCAGGCACCTGC
GCCATGTACATTGCCTGCGTCTCGACTTGCGCCAAGAACTTTGGCACCGGCAAGCATCGCGGCCTTGCTCTGGCT
ATGCCCGTCACCGGTTTCGGCCTAAGCGGCATGTGGCTTAGCCAGTTGGGCAGTCGCTTCCTCTACGAGACGAAG
CCTGACGGCTCCAAAGGCGATGTCGACGTCTATCGTTTCCTTGTTTTCCTCGCCATTCTTCTCTTCATCATGGGC
ATCATCGGCACCTTCACACTGCGTGTCGTCGGCGAGCATGACTTGATCGAGGAGGCCATCGAGGAGCTCGAGCAC
AGCGGCCTCTTGGACCAAAGCTCCCTGCTTACCAGGTCCGAGAGGGGCTTTGGCACGACTGGTCCGAGCCTTGCC
GCTGAGAGCGACCCGCTCTTGGACTCGTCCAACGGCGGCGATGCCAAGTGGAAGAAGAACTGGGTTCTCAACGCC
GAAACCCGCCGGTTCCTCACCGACAACACCATGTGGCCCTTCGCCATTGCCTTTTTTCTCATGATCGGACCCGGC
GAGGCATTTGTCAACAACCTGGGAACCGTCATCGGCACCCTGACACCTCCGCAAATGGCCGGTCAGCACACGTCG
GTGGCAACCCACGTCTCTATTTTCGGCGTCACCAGCACTGTCGCCCGCCTGCTGATCGGTACCGTTACCGACCTA
GTGGCCCCGTCCCCTGAAACTCAACACGTTCAGATCGGCCCGAGTCGCGGCCTTCGCCGGTCTTCACCGTTGAAG
CGCCTGACCATCTCTCGTGTCGTCTTCATGCTTTTCTTCGGAGTCGTCATGTCTATCGGCTTCATCTTCCTCGCC
TCTGGTGCGGCCCAGGATCACTCCGAACGCTTCTGGGTTGTCTCGGGTCTGGTAGGGGCTGGCTACGGCGCCGCT
TTTAGTTTGACGCCGCTCATCGTCACCATCATCTGGGGTGTCGAGAACTTTGCGACCAACTTTGGCATCGTCGCC
ATGCTGCCAGCCTTGGGTTCTACCTTTTGGGGTCTGGTCTACTCTGGAGTTTACCAGGCCGGGGCCAAGGTACCG
GGCTCCAAGGATTCGGGGGATACTTACGATGACGCAAATCTCTGCTACGGCATGCAGTGTTACTCGTCGGTGTAT
TGGGCCGAGGGGCTCTGTGTCTGGTTGGCCTGCGCGATGCTCTACTGGGCCTGGCAAGGCAAAAATGGATGGCAT
CATCGTGGCATTGTCATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail