Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5370
Gene name
Locationscaffold_438:3950..7858
Strand+
Gene length (bp)3908
Transcript length (bp)3801
Coding sequence length (bp)3798
Protein length (aa) 1266

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G0SB44|PO152_CHATD Nucleoporin POM152 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=POM152 PE=3 SV=1 1 1265 0.0E+00
sp|O94385|PO152_SCHPO Nucleoporin pom152 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pom152 PE=3 SV=3 61 1255 0.0E+00
sp|P39685|PO152_YEAST Nucleoporin POM152 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POM152 PE=1 SV=1 19 1253 6.0E-146

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 83 101 18
2 111 128 17
3 141 163 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5370
MSSTPRLRSGYPATPVTAARRQSPLETPSSAGTDSTLADSVSSATSSVKSPSLPLAEENVIAQRLPPQPVIPLDF
LDAPQQRLYAFAFYALLWAWKLYDWLQVVEDGDASWWLFFKWIFIDFVFFFGLPELRIPWLELSQAVVTTLFAIH
LVFNYLLMFNIPLPWQSWLLGLAKVLYDRELSISEHSVSVSNIINNHSLISGKQIINILPEGSAVLNPEHIPYCV
SPKSKATVSLPLYFNATLPVEIEIIRTDLDTNKEETIKISNRDVAKLAKSIRDQGADPSTADFNWQFPVKKPGVY
RLGKVLDEYKLEVQRITRDTYVVPCPRARFRSVDSSHRCIHDLSDLSLEVFGTPPLRIKYRRTINGKNDAFNFQS
LQPEGLVSPLLQASSGNEADFQGDLSWVRPYKIPVALNESMTASGEWQYSVEEVHDAFGNVIRYADPDGADLDVA
PPKDLNHKFHVKQRPKARMRGCDLRNPLRVAKGQHAKLPISFGLSGDVADTSHQVTWQFSPIDSLTNSGDHGDNV
SFGSHVSKNSHDEPRVLEPGLYTLTSVSSGSCQGEVDEPSSCLLLNPLQPSLSIRSEDIPDKCAGNSVGLRVDLD
LVGTPPFTVRYQILAGGQAEERTHQVPGLRSQLELIPKTAGRHRYVFTSIDDAVYTGLPLGPDQFLEQVVKPAAS
ARIANHDRVISTCLDSSVEVDVVLSGDPPFNLEWETVHDGKRKTERATGIEDGRFTIETAVFAKGGDYILALGSV
QDRRGCRTFLQDQLKILVRRQRPRAGFGLVDQKYSVMAVESDTRLRLPLRLQGDGPWTISYRNLNGTGDISTVTA
TSANDHLPVKSRGTYEILSVRDKQCPGTIDAAASKFRVDWFPRPQISLVETDSITSSPGIFVKKEVCEGDIDGFE
VRFQGSPPYHVMYEVKHQPPQGSQATSRRNFDAALPKAAVSMDTSRAGEYSYNFFGLADNLYDSDKNQSPLVVRQ
RVNAKPSAVFSKPGQSFKYCVEEQEDEDKIPMVLTGVPPFYVEIEIKHQAGSLPDTYRVPSINSNSYAMPIPREH
LRLGTQQLRVRRVRDARGCQQKYDVGGPAIQIQLFDAPSIYPLESRDDYCQGEHIVYTLSGTPPFDITYDFHGSR
KARSQTTSFDRVAEKAGEYIITGIADKASECRAVVNLRKTIHDLPRVQISRGKLSRVDIHEGNEVDILFEFWGVP
PFEFTYTRSTNAKKGQRSVVLETRHEMSYEHTKVVKASQEGTYEVVAIKDKFCSFSTQQVDRREGR
Coding >Ophio5|5370
ATGAGCTCGACGCCTCGCCTGCGGTCCGGCTATCCGGCCACTCCCGTTACCGCCGCCCGCCGGCAGTCCCCTTTA
GAGACGCCCTCGAGCGCCGGCACCGATTCTACCCTCGCCGATTCCGTATCATCGGCCACCAGCTCGGTCAAATCG
CCTTCTCTTCCGCTGGCTGAGGAGAATGTGATCGCTCAGCGCCTCCCACCTCAGCCCGTCATACCCCTCGATTTT
CTCGATGCTCCCCAGCAGCGCCTCTATGCCTTCGCTTTCTATGCCCTACTCTGGGCATGGAAGCTCTACGACTGG
CTTCAGGTCGTTGAGGACGGCGATGCCTCCTGGTGGCTGTTTTTCAAATGGATTTTCATCGATTTCGTCTTTTTT
TTCGGCCTCCCGGAGCTTAGGATCCCGTGGCTCGAGCTGTCGCAGGCTGTCGTCACCACCCTCTTCGCCATCCAC
CTCGTCTTTAATTATCTGTTGATGTTCAACATCCCGCTACCCTGGCAGTCGTGGCTTCTCGGCTTGGCCAAGGTG
CTCTATGACCGAGAACTGTCCATTTCCGAGCACAGCGTCAGTGTCTCCAACATTATCAACAATCACTCCTTGATC
TCGGGCAAGCAGATCATCAATATTCTGCCCGAGGGTTCTGCCGTTCTTAACCCCGAGCACATCCCTTACTGCGTC
AGCCCCAAGTCCAAGGCTACTGTTTCTCTCCCGCTCTACTTCAACGCCACACTTCCCGTCGAGATTGAAATCATC
CGCACCGACTTAGATACCAACAAGGAGGAGACCATCAAGATCTCGAACCGCGACGTGGCCAAGCTGGCCAAGTCA
ATTCGGGACCAGGGCGCTGACCCGAGCACGGCCGACTTCAACTGGCAGTTTCCGGTCAAGAAGCCGGGCGTCTAT
CGTCTGGGCAAAGTCTTGGACGAGTACAAGCTGGAGGTTCAAAGGATCACCAGGGACACATATGTTGTCCCTTGC
CCTCGCGCCCGCTTCCGGTCCGTCGACTCGTCCCATCGATGCATCCACGATCTGTCCGATTTGTCGCTTGAGGTG
TTTGGCACGCCGCCGCTTAGAATCAAATATCGCCGAACCATCAACGGCAAGAATGACGCGTTCAATTTCCAGAGC
CTCCAGCCCGAAGGGCTCGTCTCGCCCTTGCTTCAGGCGTCATCGGGCAACGAGGCCGACTTCCAGGGTGACCTC
TCCTGGGTGCGGCCCTACAAGATTCCCGTGGCTCTCAACGAATCCATGACTGCTTCTGGCGAGTGGCAGTACTCG
GTCGAGGAGGTCCACGATGCCTTTGGGAATGTCATCCGATACGCGGATCCGGACGGCGCCGACCTCGATGTCGCG
CCTCCCAAGGACCTGAACCACAAGTTCCATGTCAAGCAGCGGCCCAAGGCCCGCATGCGAGGCTGCGACCTCAGA
AACCCGCTCAGGGTCGCCAAGGGACAGCATGCCAAGCTACCCATCAGCTTTGGCCTGTCCGGCGACGTAGCCGAC
ACCTCACACCAAGTGACTTGGCAATTCTCGCCCATTGACTCGTTGACCAACAGCGGCGATCACGGCGACAATGTC
TCCTTCGGCAGTCATGTCTCCAAAAACTCGCACGACGAGCCTCGTGTCTTGGAGCCGGGCTTGTACACGCTGACA
TCCGTGTCGAGTGGCTCATGTCAGGGCGAGGTGGACGAACCGTCTTCGTGTCTGCTTCTCAACCCCCTGCAGCCG
AGCCTGTCTATAAGGTCCGAGGATATCCCAGATAAGTGTGCAGGAAACTCTGTCGGCCTGCGCGTGGATCTAGAT
CTCGTTGGCACCCCGCCCTTCACCGTCCGCTATCAGATTCTCGCTGGCGGACAGGCCGAGGAGCGGACACACCAA
GTTCCGGGCCTGCGGTCCCAGTTGGAGCTGATTCCCAAGACGGCTGGTCGACACCGATACGTCTTCACGTCAATC
GATGACGCTGTCTATACGGGGCTGCCGCTCGGCCCAGACCAGTTTCTCGAACAGGTGGTGAAGCCGGCCGCCTCT
GCCAGGATCGCCAACCACGATAGGGTTATTAGCACATGTCTCGATTCCAGCGTCGAGGTTGACGTTGTTCTCTCG
GGCGATCCCCCCTTCAACCTCGAATGGGAAACGGTCCACGACGGCAAGCGAAAGACGGAGCGGGCGACGGGCATC
GAGGATGGCCGCTTCACCATCGAAACGGCCGTCTTTGCCAAGGGCGGAGATTACATACTCGCCCTCGGTAGCGTC
CAGGACAGACGCGGCTGTCGGACCTTTTTGCAGGATCAGCTCAAGATACTGGTGCGCAGACAGAGGCCGCGCGCC
GGCTTCGGGCTGGTGGATCAAAAGTACAGCGTCATGGCCGTCGAGTCCGATACGCGCCTTCGCCTACCTCTTCGC
CTTCAGGGAGATGGTCCCTGGACCATAAGCTACCGCAATCTCAACGGGACCGGCGACATCTCGACCGTGACGGCT
ACCAGCGCTAATGACCACCTGCCGGTCAAGTCCCGTGGCACCTACGAGATCCTAAGTGTCAGAGACAAGCAATGC
CCCGGCACCATCGATGCCGCGGCCTCCAAATTCCGAGTCGACTGGTTCCCTCGCCCCCAGATCTCTCTGGTTGAG
ACGGACAGCATCACGTCCAGCCCGGGCATCTTCGTCAAGAAGGAGGTGTGCGAGGGCGACATTGATGGCTTCGAG
GTTAGGTTTCAAGGATCTCCTCCGTACCATGTCATGTACGAAGTCAAGCACCAGCCTCCTCAGGGATCGCAAGCT
ACCAGCCGAAGAAACTTTGACGCGGCGCTCCCGAAAGCGGCCGTGTCCATGGATACGTCGAGGGCGGGCGAATAC
AGCTACAACTTCTTTGGCCTGGCCGACAACCTCTATGACAGCGATAAGAACCAGTCTCCGCTGGTGGTCCGGCAG
CGTGTCAATGCCAAGCCATCTGCCGTCTTCTCCAAGCCCGGGCAATCCTTCAAGTACTGTGTGGAGGAGCAGGAA
GACGAGGATAAGATTCCGATGGTGCTCACCGGCGTGCCGCCCTTTTACGTCGAGATCGAGATCAAGCACCAGGCC
GGTTCTCTGCCCGACACGTACCGCGTGCCGTCGATCAACTCCAACTCGTATGCCATGCCGATCCCGCGAGAGCAC
CTCCGGCTCGGGACGCAGCAGCTTCGGGTGCGCAGAGTACGCGATGCACGCGGGTGCCAGCAAAAGTACGACGTC
GGTGGTCCCGCCATCCAGATCCAGCTGTTCGACGCTCCGTCCATCTACCCGCTCGAGTCTCGCGACGACTACTGC
CAGGGCGAGCACATCGTCTATACGCTCTCGGGCACACCTCCCTTTGACATTACGTACGACTTTCACGGCTCGCGC
AAGGCCCGGTCGCAGACGACGAGCTTCGACCGCGTGGCGGAGAAGGCGGGCGAGTACATCATCACGGGCATCGCG
GACAAGGCCAGTGAGTGTCGCGCCGTCGTCAACCTGCGCAAGACGATCCACGACCTGCCGCGAGTGCAGATCAGT
CGCGGCAAGCTCTCGCGCGTCGACATCCACGAGGGCAACGAGGTGGACATACTCTTTGAATTCTGGGGCGTCCCG
CCCTTTGAGTTCACCTACACGAGGAGCACGAATGCCAAGAAGGGCCAGCGAAGCGTCGTGCTCGAAACGAGGCAC
GAAATGTCGTACGAGCACACCAAGGTCGTCAAGGCTAGCCAGGAGGGCACGTACGAGGTGGTGGCCATCAAGGAC
AAATTTTGCTCCTTTTCTACCCAGCAGGTTGACAGGAGGGAGGGCCGC
Transcript >Ophio5|5370
ATGAGCTCGACGCCTCGCCTGCGGTCCGGCTATCCGGCCACTCCCGTTACCGCCGCCCGCCGGCAGTCCCCTTTA
GAGACGCCCTCGAGCGCCGGCACCGATTCTACCCTCGCCGATTCCGTATCATCGGCCACCAGCTCGGTCAAATCG
CCTTCTCTTCCGCTGGCTGAGGAGAATGTGATCGCTCAGCGCCTCCCACCTCAGCCCGTCATACCCCTCGATTTT
CTCGATGCTCCCCAGCAGCGCCTCTATGCCTTCGCTTTCTATGCCCTACTCTGGGCATGGAAGCTCTACGACTGG
CTTCAGGTCGTTGAGGACGGCGATGCCTCCTGGTGGCTGTTTTTCAAATGGATTTTCATCGATTTCGTCTTTTTT
TTCGGCCTCCCGGAGCTTAGGATCCCGTGGCTCGAGCTGTCGCAGGCTGTCGTCACCACCCTCTTCGCCATCCAC
CTCGTCTTTAATTATCTGTTGATGTTCAACATCCCGCTACCCTGGCAGTCGTGGCTTCTCGGCTTGGCCAAGGTG
CTCTATGACCGAGAACTGTCCATTTCCGAGCACAGCGTCAGTGTCTCCAACATTATCAACAATCACTCCTTGATC
TCGGGCAAGCAGATCATCAATATTCTGCCCGAGGGTTCTGCCGTTCTTAACCCCGAGCACATCCCTTACTGCGTC
AGCCCCAAGTCCAAGGCTACTGTTTCTCTCCCGCTCTACTTCAACGCCACACTTCCCGTCGAGATTGAAATCATC
CGCACCGACTTAGATACCAACAAGGAGGAGACCATCAAGATCTCGAACCGCGACGTGGCCAAGCTGGCCAAGTCA
ATTCGGGACCAGGGCGCTGACCCGAGCACGGCCGACTTCAACTGGCAGTTTCCGGTCAAGAAGCCGGGCGTCTAT
CGTCTGGGCAAAGTCTTGGACGAGTACAAGCTGGAGGTTCAAAGGATCACCAGGGACACATATGTTGTCCCTTGC
CCTCGCGCCCGCTTCCGGTCCGTCGACTCGTCCCATCGATGCATCCACGATCTGTCCGATTTGTCGCTTGAGGTG
TTTGGCACGCCGCCGCTTAGAATCAAATATCGCCGAACCATCAACGGCAAGAATGACGCGTTCAATTTCCAGAGC
CTCCAGCCCGAAGGGCTCGTCTCGCCCTTGCTTCAGGCGTCATCGGGCAACGAGGCCGACTTCCAGGGTGACCTC
TCCTGGGTGCGGCCCTACAAGATTCCCGTGGCTCTCAACGAATCCATGACTGCTTCTGGCGAGTGGCAGTACTCG
GTCGAGGAGGTCCACGATGCCTTTGGGAATGTCATCCGATACGCGGATCCGGACGGCGCCGACCTCGATGTCGCG
CCTCCCAAGGACCTGAACCACAAGTTCCATGTCAAGCAGCGGCCCAAGGCCCGCATGCGAGGCTGCGACCTCAGA
AACCCGCTCAGGGTCGCCAAGGGACAGCATGCCAAGCTACCCATCAGCTTTGGCCTGTCCGGCGACGTAGCCGAC
ACCTCACACCAAGTGACTTGGCAATTCTCGCCCATTGACTCGTTGACCAACAGCGGCGATCACGGCGACAATGTC
TCCTTCGGCAGTCATGTCTCCAAAAACTCGCACGACGAGCCTCGTGTCTTGGAGCCGGGCTTGTACACGCTGACA
TCCGTGTCGAGTGGCTCATGTCAGGGCGAGGTGGACGAACCGTCTTCGTGTCTGCTTCTCAACCCCCTGCAGCCG
AGCCTGTCTATAAGGTCCGAGGATATCCCAGATAAGTGTGCAGGAAACTCTGTCGGCCTGCGCGTGGATCTAGAT
CTCGTTGGCACCCCGCCCTTCACCGTCCGCTATCAGATTCTCGCTGGCGGACAGGCCGAGGAGCGGACACACCAA
GTTCCGGGCCTGCGGTCCCAGTTGGAGCTGATTCCCAAGACGGCTGGTCGACACCGATACGTCTTCACGTCAATC
GATGACGCTGTCTATACGGGGCTGCCGCTCGGCCCAGACCAGTTTCTCGAACAGGTGGTGAAGCCGGCCGCCTCT
GCCAGGATCGCCAACCACGATAGGGTTATTAGCACATGTCTCGATTCCAGCGTCGAGGTTGACGTTGTTCTCTCG
GGCGATCCCCCCTTCAACCTCGAATGGGAAACGGTCCACGACGGCAAGCGAAAGACGGAGCGGGCGACGGGCATC
GAGGATGGCCGCTTCACCATCGAAACGGCCGTCTTTGCCAAGGGCGGAGATTACATACTCGCCCTCGGTAGCGTC
CAGGACAGACGCGGCTGTCGGACCTTTTTGCAGGATCAGCTCAAGATACTGGTGCGCAGACAGAGGCCGCGCGCC
GGCTTCGGGCTGGTGGATCAAAAGTACAGCGTCATGGCCGTCGAGTCCGATACGCGCCTTCGCCTACCTCTTCGC
CTTCAGGGAGATGGTCCCTGGACCATAAGCTACCGCAATCTCAACGGGACCGGCGACATCTCGACCGTGACGGCT
ACCAGCGCTAATGACCACCTGCCGGTCAAGTCCCGTGGCACCTACGAGATCCTAAGTGTCAGAGACAAGCAATGC
CCCGGCACCATCGATGCCGCGGCCTCCAAATTCCGAGTCGACTGGTTCCCTCGCCCCCAGATCTCTCTGGTTGAG
ACGGACAGCATCACGTCCAGCCCGGGCATCTTCGTCAAGAAGGAGGTGTGCGAGGGCGACATTGATGGCTTCGAG
GTTAGGTTTCAAGGATCTCCTCCGTACCATGTCATGTACGAAGTCAAGCACCAGCCTCCTCAGGGATCGCAAGCT
ACCAGCCGAAGAAACTTTGACGCGGCGCTCCCGAAAGCGGCCGTGTCCATGGATACGTCGAGGGCGGGCGAATAC
AGCTACAACTTCTTTGGCCTGGCCGACAACCTCTATGACAGCGATAAGAACCAGTCTCCGCTGGTGGTCCGGCAG
CGTGTCAATGCCAAGCCATCTGCCGTCTTCTCCAAGCCCGGGCAATCCTTCAAGTACTGTGTGGAGGAGCAGGAA
GACGAGGATAAGATTCCGATGGTGCTCACCGGCGTGCCGCCCTTTTACGTCGAGATCGAGATCAAGCACCAGGCC
GGTTCTCTGCCCGACACGTACCGCGTGCCGTCGATCAACTCCAACTCGTATGCCATGCCGATCCCGCGAGAGCAC
CTCCGGCTCGGGACGCAGCAGCTTCGGGTGCGCAGAGTACGCGATGCACGCGGGTGCCAGCAAAAGTACGACGTC
GGTGGTCCCGCCATCCAGATCCAGCTGTTCGACGCTCCGTCCATCTACCCGCTCGAGTCTCGCGACGACTACTGC
CAGGGCGAGCACATCGTCTATACGCTCTCGGGCACACCTCCCTTTGACATTACGTACGACTTTCACGGCTCGCGC
AAGGCCCGGTCGCAGACGACGAGCTTCGACCGCGTGGCGGAGAAGGCGGGCGAGTACATCATCACGGGCATCGCG
GACAAGGCCAGTGAGTGTCGCGCCGTCGTCAACCTGCGCAAGACGATCCACGACCTGCCGCGAGTGCAGATCAGT
CGCGGCAAGCTCTCGCGCGTCGACATCCACGAGGGCAACGAGGTGGACATACTCTTTGAATTCTGGGGCGTCCCG
CCCTTTGAGTTCACCTACACGAGGAGCACGAATGCCAAGAAGGGCCAGCGAAGCGTCGTGCTCGAAACGAGGCAC
GAAATGTCGTACGAGCACACCAAGGTCGTCAAGGCTAGCCAGGAGGGCACGTACGAGGTGGTGGCCATCAAGGAC
AAATTTTGCTCCTTTTCTACCCAGCAGGTTGACAGGAGGGAGGGCCGCTGA
Gene >Ophio5|5370
ATGAGCTCGACGCCTCGCCTGCGGTCCGGCTATCCGGCCACTCCCGTTACCGCCGCCCGCCGGCAGTCCCCTTTA
GAGACGCCCTCGAGCGCCGGCACCGATTCTACCCTCGCCGATTCCGTATCATCGGCCACCAGCTCGGTCAAATCG
CCTTCTCTTCCGCTGGCTGAGGAGAATGTGATCGCTCAGCGCCTCCCACCTCAGCCCGTCATACCCCTCGATTTT
CTCGATGCTCCCCAGCAGCGCCTCTATGCCTTCGCTTTCTATGCCCTACTCTGGGCATGGAAGCTCTACGACTGG
CTTCAGGTCGTTGAGGACGGCGATGCCTCCTGGTGGCTGTTTTTCAAATGGATTTTCATCGATTTCGTCTTTTTT
TTCGGCCTCCCGGAGCTTAGGATCCCGTGGCTCGAGCTGTCGCAGGCTGTCGTCACCACCCTCTTCGCCATCCAC
CTCGTCTTTAATTATCTGTTGATGTTCAACATCCCGGTACGTTTACCTCTCCCCCGCGCTCACCCGTCCGCTGCC
TAATCTTGTCTGCTTGTACAGCTACCCTGGCAGTCGTGGCTTCTCGGCTTGGCCAAGGTGCTCTATGACCGAGAA
CTGTCCATTTCCGAGCACAGCGTCAGTGTCTCCAACATTATCAACAATCACTCCTTGATCTCGGGCAAGCAGATC
ATCAATATTCTGCCCGAGGGTTCTGCCGTTCTTAACCCCGAGCACATCCCTTACTGCGTCAGCCCCAAGTCCAAG
GCTACTGTTTCTCTCCCGCTCTACTTCAACGCCACACTTCCCGTCGAGATTGAAATCATCCGCACCGACTTAGAT
ACCAACAAGGAGGAGACCATCAAGATCTCGAACCGCGACGTGGCCAAGCTGGCCAAGTCAATTCGGGACCAGGGC
GCTGACCCGAGCACGGCCGACTTCAACTGGCAGTTTCCGGTCAAGAAGCCGGGCGTCTATCGTCTGGGCAAAGTC
TTGGACGAGTACAAGCTGGAGGTTCAAAGGATCACCAGGGACACATATGTTGTCCCTTGCCCTCGCGCCCGCTTC
CGGTCCGTCGACTCGTCCCATCGATGCATCCACGATCTGTCCGATTTGTCGCTTGAGGTGTTTGGCACGCCGCCG
CTTAGAATCAAATATCGCCGAACCATCAACGGCAAGAATGACGCGTTCAATTTCCAGAGCCTCCAGCCCGAAGGG
CTCGTCTCGCCCTTGCTTCAGGCGTCATCGGGCAACGAGGCCGACTTCCAGGGTGACCTCTCCTGGGTGCGGCCC
TACAAGATTCCCGTGGCTCTCAACGAATCCATGACTGCTTCTGGCGAGTGGCAGTACTCGGTCGAGGAGGTCCAC
GATGCCTTTGGGAATGTCATCCGATACGCGGATCCGGACGGCGCCGACCTCGATGTCGCGCCTCCCAAGGACCTG
AACCACAAGTTCCATGTCAAGCAGCGGCCCAAGGCCCGCATGCGAGGCTGCGACCTCAGAAACCCGCTCAGGGTC
GCCAAGGGACAGCATGCCAAGCTACCCATCAGCTTTGGCCTGTCCGGCGACGTAGCCGACACCTCACACCAAGTG
ACTTGGCAATTCTCGCCCATTGACTCGTTGACCAACAGCGGCGATCACGGCGACAATGTCTCCTTCGGCAGTCAT
GTCTCCAAAAACTCGCACGACGAGCCTCGTGTCTTGGAGCCGGGCTTGTACACGCTGACATCCGTGTCGAGTGGC
TCATGTCAGGGCGAGGTGGACGAACCGTCTTCGTGTCTGCTTCTCAACCCCCTGCAGCCGAGCCTGTCTATAAGG
TCCGAGGATATCCCAGATAAGTGTGCAGGAAACTCTGTCGGCCTGCGCGTGGATCTAGATCTCGTTGGCACCCCG
CCCTTCACCGTCCGCTATCAGATTCTCGCTGGCGGACAGGCCGAGGAGCGGACACACCAAGTTCCGGGCCTGCGG
TCCCAGTTGGAGCTGATTCCCAAGACGGCTGGTCGACACCGATACGTCTTCACGTCAATCGATGACGCTGTCTAT
ACGGGGCTGCCGCTCGGCCCAGACCAGTTTCTCGAACAGGTGGTGAAGCCGGCCGCCTCTGCCAGGATCGCCAAC
CACGATAGGGTTATTAGCACATGTCTCGATTCCAGCGTCGAGGTTGACGTTGTTCTCTCGGGCGATCCCCCCTTC
AACCTCGAATGGGAAACGGTCCACGACGGCAAGCGAAAGACGGAGCGGGCGACGGGCATCGAGGATGGCCGCTTC
ACCATCGAAACGGCCGTCTTTGCCAAGGGCGGAGATTACATACTCGCCCTCGGTAGCGTCCAGGACAGACGCGGC
TGTCGGACCTTTTTGCAGGATCAGCTCAAGATACTGGTGCGCAGACAGAGGCCGCGCGCCGGCTTCGGGCTGGTG
GATCAAAAGTACAGCGTCATGGCCGTCGAGTCCGATACGCGCCTTCGCCTACCTCTTCGCCTTCAGGGAGATGGT
CCCTGGACCATAAGCTACCGCAATCTCAACGGGACCGGCGACATCTCGACCGTGACGGCTACCAGCGCTAATGAC
CACCTGCCGGTCAAGTCCCGTGGCACCTACGAGATCCTAAGTGTCAGAGACAAGCAATGCCCCGGCACCATCGAT
GCCGCGGCCTCCAAATTCCGAGTCGACTGGTTCCCTCGCCCCCAGATCTCTCTGGTTGAGACGGACAGCATCACG
TCCAGCCCGGGCATCTTCGTCAAGAAGGAGGTGTGCGAGGGCGACATTGATGGCTTCGAGGTTAGGTTTCAAGGT
AAGTTTTCCAGTCTGACGGAGCAAGCGGTTGCTGAGCCATGGCAGGATCTCCTCCGTACCATGTCATGTACGAAG
TCAAGCACCAGCCTCCTCAGGGATCGCAAGCTACCAGCCGAAGAAACTTTGACGCGGCGCTCCCGAAAGCGGCCG
TGTCCATGGATACGTCGAGGGCGGGCGAATACAGCTACAACTTCTTTGGCCTGGCCGACAACCTCTATGACAGCG
ATAAGAACCAGTCTCCGCTGGTGGTCCGGCAGCGTGTCAATGCCAAGCCATCTGCCGTCTTCTCCAAGCCCGGGC
AATCCTTCAAGTACTGTGTGGAGGAGCAGGAAGACGAGGATAAGATTCCGATGGTGCTCACCGGCGTGCCGCCCT
TTTACGTCGAGATCGAGATCAAGCACCAGGCCGGTTCTCTGCCCGACACGTACCGCGTGCCGTCGATCAACTCCA
ACTCGTATGCCATGCCGATCCCGCGAGAGCACCTCCGGCTCGGGACGCAGCAGCTTCGGGTGCGCAGAGTACGCG
ATGCACGCGGGTGCCAGCAAAAGTACGACGTCGGTGGTCCCGCCATCCAGATCCAGCTGTTCGACGCTCCGTCCA
TCTACCCGCTCGAGTCTCGCGACGACTACTGCCAGGGCGAGCACATCGTCTATACGCTCTCGGGCACACCTCCCT
TTGACATTACGTACGACTTTCACGGCTCGCGCAAGGCCCGGTCGCAGACGACGAGCTTCGACCGCGTGGCGGAGA
AGGCGGGCGAGTACATCATCACGGGCATCGCGGACAAGGCCAGTGAGTGTCGCGCCGTCGTCAACCTGCGCAAGA
CGATCCACGACCTGCCGCGAGTGCAGATCAGTCGCGGCAAGCTCTCGCGCGTCGACATCCACGAGGGCAACGAGG
TGGACATACTCTTTGAATTCTGGGGCGTCCCGCCCTTTGAGTTCACCTACACGAGGAGCACGAATGCCAAGAAGG
GCCAGCGAAGCGTCGTGCTCGAAACGAGGCACGAAATGTCGTACGAGCACACCAAGGTCGTCAAGGCTAGCCAGG
AGGGCACGTACGAGGTGGTGGCCATCAAGGACAAATTTTGCTCCTTTTCTACCCAGCAGGTTGACAGGAGGGAGG
GCCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail