Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5362
Gene name
Locationscaffold_437:3476..4883
Strand+
Gene length (bp)1407
Transcript length (bp)1311
Coding sequence length (bp)1308
Protein length (aa) 436

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09751 Es2 Nuclear protein Es2 2.0E-105 30 401

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O44424|DGC14_DROME Protein DGCR14 homolog OS=Drosophila melanogaster GN=Es2 PE=1 SV=2 7 433 2.0E-18
sp|Q96DF8|DGC14_HUMAN Protein DGCR14 OS=Homo sapiens GN=DGCR14 PE=1 SV=1 33 372 2.0E-12
sp|O70279|DGC14_MOUSE Protein DGCR14 OS=Mus musculus GN=Dgcr14 PE=1 SV=2 33 327 5.0E-12
sp|P34420|DGC14_CAEEL ES2 similar protein 2 OS=Caenorhabditis elegans GN=ess-2 PE=3 SV=2 25 404 1.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5362
MEPTSQALVRKRADSELMPPPPTAKKVKRPKDVLSEDDYTASISHIILRDFFPGITVSAVQHEYLDAVESRNSTW
IASAGQRLHDAMTPGRWRAQSAAVRSHDRGPTPASFVADTPSTAASPAVEEKPLPGSHMRLSDFQAKYTSEDNES
FYKLLDKQNQKKTEKYAWMWNNNKLPSKQMLKQKEVVDRLSKSRNIVDDGFKRDRLAIKDSDERPARPDSWKAAP
RNGFMFEPEGLDEGVVTVAQKAEEASRMPPKTIIYDNTRIPEPYAPDRPPSPTLSSIRDAIAGRPRPQDRDTSDV
GGGETPRVNGYTFVDDDDDEPVFADSPPAISLGPGDAHNPFRLQQLRKRESLHERLVERIAKTNKESSRHGLSGR
PELQHVPKFPSSPRKTGDFTPAAQRLLNKMGTPKGRTPGSPFDHFATPNGTISSADEPTEM
Coding >Ophio5|5362
ATGGAACCGACGTCGCAGGCTCTGGTGCGAAAAAGGGCCGACTCAGAATTGATGCCTCCTCCGCCTACAGCCAAG
AAAGTAAAAAGACCCAAGGATGTCCTGAGCGAAGACGACTACACGGCTTCAATCTCGCACATAATTCTGAGGGAC
TTTTTCCCCGGCATCACGGTCTCTGCCGTGCAACACGAGTACCTGGATGCGGTCGAATCTCGGAATTCTACCTGG
ATCGCGAGCGCGGGCCAGAGGCTGCACGATGCCATGACACCAGGCCGATGGCGAGCTCAGTCCGCCGCTGTACGC
TCTCACGACCGCGGGCCGACCCCAGCCTCGTTCGTCGCGGACACACCAAGCACGGCGGCTTCCCCTGCCGTTGAG
GAGAAGCCCTTACCAGGCTCCCACATGAGACTTTCCGACTTCCAGGCCAAATACACGAGCGAGGACAACGAGAGC
TTCTACAAACTGTTGGACAAGCAGAATCAAAAGAAGACGGAGAAATATGCCTGGATGTGGAACAACAATAAGCTG
CCCTCAAAGCAGATGCTGAAGCAAAAGGAAGTTGTAGATCGGCTCAGCAAATCGCGTAATATCGTCGACGACGGA
TTCAAGCGCGATCGCCTGGCCATCAAGGACTCGGACGAGCGTCCGGCAAGGCCTGACTCCTGGAAAGCCGCGCCG
AGAAATGGCTTTATGTTCGAACCGGAAGGATTAGACGAGGGTGTCGTCACCGTCGCTCAAAAGGCCGAAGAGGCG
TCCCGAATGCCACCAAAAACCATCATCTATGACAATACTAGGATTCCGGAACCGTACGCTCCGGATCGACCTCCC
TCGCCCACCCTATCCTCGATTCGGGACGCCATCGCGGGAAGGCCGCGCCCACAAGATCGGGACACTAGCGACGTT
GGCGGGGGGGAGACGCCCAGAGTCAACGGCTACACGTTTGTCGACGACGATGATGACGAGCCAGTCTTTGCGGAC
TCTCCGCCTGCCATTAGCCTGGGCCCAGGCGACGCACACAACCCCTTCAGGTTACAGCAGCTGAGGAAGCGGGAG
TCGCTACACGAACGACTGGTGGAGCGGATAGCCAAAACCAACAAAGAGTCTTCTCGCCATGGGCTCAGCGGAAGG
CCTGAGTTGCAGCACGTCCCAAAGTTCCCCAGCAGCCCTCGAAAAACCGGAGATTTCACACCAGCGGCACAGAGA
CTGCTCAATAAAATGGGGACACCGAAAGGCAGGACGCCCGGCAGCCCCTTTGACCACTTTGCCACACCAAACGGC
ACAATTAGCTCGGCCGACGAGCCCACGGAAATG
Transcript >Ophio5|5362
ATGGAACCGACGTCGCAGGCTCTGGTGCGAAAAAGGGCCGACTCAGAATTGATGCCTCCTCCGCCTACAGCCAAG
AAAGTAAAAAGACCCAAGGATGTCCTGAGCGAAGACGACTACACGGCTTCAATCTCGCACATAATTCTGAGGGAC
TTTTTCCCCGGCATCACGGTCTCTGCCGTGCAACACGAGTACCTGGATGCGGTCGAATCTCGGAATTCTACCTGG
ATCGCGAGCGCGGGCCAGAGGCTGCACGATGCCATGACACCAGGCCGATGGCGAGCTCAGTCCGCCGCTGTACGC
TCTCACGACCGCGGGCCGACCCCAGCCTCGTTCGTCGCGGACACACCAAGCACGGCGGCTTCCCCTGCCGTTGAG
GAGAAGCCCTTACCAGGCTCCCACATGAGACTTTCCGACTTCCAGGCCAAATACACGAGCGAGGACAACGAGAGC
TTCTACAAACTGTTGGACAAGCAGAATCAAAAGAAGACGGAGAAATATGCCTGGATGTGGAACAACAATAAGCTG
CCCTCAAAGCAGATGCTGAAGCAAAAGGAAGTTGTAGATCGGCTCAGCAAATCGCGTAATATCGTCGACGACGGA
TTCAAGCGCGATCGCCTGGCCATCAAGGACTCGGACGAGCGTCCGGCAAGGCCTGACTCCTGGAAAGCCGCGCCG
AGAAATGGCTTTATGTTCGAACCGGAAGGATTAGACGAGGGTGTCGTCACCGTCGCTCAAAAGGCCGAAGAGGCG
TCCCGAATGCCACCAAAAACCATCATCTATGACAATACTAGGATTCCGGAACCGTACGCTCCGGATCGACCTCCC
TCGCCCACCCTATCCTCGATTCGGGACGCCATCGCGGGAAGGCCGCGCCCACAAGATCGGGACACTAGCGACGTT
GGCGGGGGGGAGACGCCCAGAGTCAACGGCTACACGTTTGTCGACGACGATGATGACGAGCCAGTCTTTGCGGAC
TCTCCGCCTGCCATTAGCCTGGGCCCAGGCGACGCACACAACCCCTTCAGGTTACAGCAGCTGAGGAAGCGGGAG
TCGCTACACGAACGACTGGTGGAGCGGATAGCCAAAACCAACAAAGAGTCTTCTCGCCATGGGCTCAGCGGAAGG
CCTGAGTTGCAGCACGTCCCAAAGTTCCCCAGCAGCCCTCGAAAAACCGGAGATTTCACACCAGCGGCACAGAGA
CTGCTCAATAAAATGGGGACACCGAAAGGCAGGACGCCCGGCAGCCCCTTTGACCACTTTGCCACACCAAACGGC
ACAATTAGCTCGGCCGACGAGCCCACGGAAATGTGA
Gene >Ophio5|5362
ATGGAACCGACGTCGCAGGCTCTGGTGCGAAAAAGGGCCGACTCAGAATTGATGCCTCCTCCGCCTACAGCCAAG
AAAGTAAAAAGACCCAAGGATGTCCTGAGCGAAGACGACTACACGGCTTCAATCTCGCACATAATTCTGAGGGAC
TTTTTCCCCGGCATCACGGTCTCTGCCGTGCAACACGAGTACCTGGATGCGGTCGAATCTCGGAATTCTACCTGG
ATCGCGAGCGCGGGCCAGAGGCTGCACGATGCCATGACACCAGGCCGATGGCGAGCTCAGTCCGCCGCTGTACGC
TCTCACGACCGCGGGCCGACCCCAGCCTCGTTCGTCGCGGACACACCAAGCACGGCGGCTTCCCCTGCCGTTGAG
GAGAAGCCCTTACCAGGCTCCCACATGAGACTTTCCGACTTCCAGGCCAAATACACGAGCGAGGACAACGAGAGC
TTCTACAAACTGTTGGACAAGCAGAATCAAAAGAAGACGGAGAAATATGCCTGGATGTGGAACAACAATAAGCTG
CCCTCAAAGCAGATGCTGAAGCAAAAGGAAGTTGTAGATCGGCTCAGCAAATCGCGTAATATCGTCGACGACGGA
TTCAAGCGCGATCGCCTGGCCATCAAGGACTCGGACGAGCGTCCGGCAAGGCCTGACTCCTGGAAAGCCGCGCCG
AGAAATGGCTTTATGTTCGAACCGGAAGGATTAGACGAGGGTGTCGTCACCGTCGCTCAAAAGGCCGAAGAGGCG
TCCCGAATGCCACCAAAAACCATCATCTATGACAATACTAGGATTCCGGAACCGTACGCTCCGGATCGACCTCCC
TCGCCCACCCTATCCTCGATTCGGGACGCCATCGCGGGAAGGCCGCGCCCACAAGATCGGGACACTAGCGACGTT
GGCGGGGGGGAGACGCCCAGAGTCAACGGCTACACGTTTGTCGACGACGATGATGACGAGCCAGTCTTTGCGGAC
TCTCCGCCTGCCATTAGCCTGGGCCCAGGCGACGCACACAACCCCTTCAGGTTACAGCAGCTGAGGAAGCGGGAG
TCGCTACACGAACGACTGGTGGAGCGGATAGCCAAAACCAACAAAGAGTCTTCTCGCCATGGGCTCAGCGGAAGG
CCTGAGTTGCAGCACGTCCCAAAGTTCCCCAGCAGCCCTCGAAAAACCGGAGATTTCACACCAGCGGCACAGAGA
CTGCTCAATAAAATGGGGACACCGAAAGGCAGGACGCCCGGCAGCCCCTTTGACCACTTTGCCACACCAGTCAAA
CGACGGGGCTCGCGCTTGAAGTCTAGCACGAAGACGAAGACAGAACGGCACAATTAGCTCGGCCGACGAGCCCAC
GGAAATGTACGACTACCGATTTTCACAAAGAATCCGATTAACTCATTGGGTAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail