Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5344
Gene name
Locationscaffold_435:1730..2505
Strand-
Gene length (bp)775
Transcript length (bp)636
Coding sequence length (bp)633
Protein length (aa) 211

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.0723 0.0766 0.8657 0.3708 0.0836 0.0022 0.1208 0.1281 0.1707 0.0057

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999736

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 1456.69 589.96 2323.42
CcL In ants, during behavior modification 2842.36 868.91 4815.81
CcD In ants, recently dead 2933.63 928.59 4938.67

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.026744 yes
SC16a CcD 0.021057 yes
CcL CcD 0.940214 no

Orthologs

Orthofinder run ID4
Orthogroup4518
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4609
Ophiocordyceps australis map64 (Brazil) OphauB2|5460
Ophiocordyceps camponoti-floridani Ophcf2|04650
Ophiocordyceps camponoti-rufipedis Ophun1|3820
Ophiocordyceps kimflemingae Ophio5|5344 (this protein)
Ophiocordyceps subramaniannii Hirsu2|944

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5344
MRASTALIALGAAVASAQSNGVGNYSSELDMHIDPNSIGSQQRAIWCRAQTNTCGLLCDNNTSKNSCVQEKLEYD
CICAANNSAPALQYYQQTIPTFICETLFSQCDKQNVGNAEGQQSCITNIQNLCGKGAPPKVSSGSSSGGDSSGGD
SSDSSDSSSTAASSSSQATATQPGNNNAVTTTRSGGLAAPTKVPAANGVAFAVAVGALALL
Coding >Ophio5|5344
ATGCGTGCCTCTACCGCACTCATCGCCCTCGGCGCTGCCGTTGCCTCGGCCCAGTCCAACGGAGTTGGCAACTAC
TCGAGCGAGCTGGACATGCACATTGATCCCAACTCGATTGGCTCCCAGCAGCGAGCTATCTGGTGTCGCGCTCAG
ACCAACACTTGCGGACTCCTCTGCGATAACAACACCAGCAAGAACAGTTGCGTCCAGGAGAAGCTTGAGTACGAC
TGTATCTGTGCTGCCAACAACTCGGCCCCGGCCCTGCAGTATTACCAGCAGACCATCCCCACGTTCATCTGTGAG
ACACTTTTCAGCCAGTGCGACAAGCAGAACGTCGGCAACGCAGAAGGTCAGCAGTCGTGCATCACCAACATCCAG
AACCTGTGCGGCAAGGGTGCCCCGCCCAAGGTGTCGAGCGGCAGCAGCAGCGGCGGTGACAGCAGCGGCGGTGAC
AGCAGCGACAGCAGCGACAGCTCCAGCACGGCCGCCTCGAGCTCGTCGCAGGCGACTGCGACGCAGCCGGGCAAC
AACAACGCCGTGACGACGACGAGGTCGGGTGGCCTCGCTGCCCCGACCAAGGTTCCGGCTGCCAATGGTGTGGCC
TTTGCCGTTGCCGTGGGCGCTCTCGCTCTTCTC
Transcript >Ophio5|5344
ATGCGTGCCTCTACCGCACTCATCGCCCTCGGCGCTGCCGTTGCCTCGGCCCAGTCCAACGGAGTTGGCAACTAC
TCGAGCGAGCTGGACATGCACATTGATCCCAACTCGATTGGCTCCCAGCAGCGAGCTATCTGGTGTCGCGCTCAG
ACCAACACTTGCGGACTCCTCTGCGATAACAACACCAGCAAGAACAGTTGCGTCCAGGAGAAGCTTGAGTACGAC
TGTATCTGTGCTGCCAACAACTCGGCCCCGGCCCTGCAGTATTACCAGCAGACCATCCCCACGTTCATCTGTGAG
ACACTTTTCAGCCAGTGCGACAAGCAGAACGTCGGCAACGCAGAAGGTCAGCAGTCGTGCATCACCAACATCCAG
AACCTGTGCGGCAAGGGTGCCCCGCCCAAGGTGTCGAGCGGCAGCAGCAGCGGCGGTGACAGCAGCGGCGGTGAC
AGCAGCGACAGCAGCGACAGCTCCAGCACGGCCGCCTCGAGCTCGTCGCAGGCGACTGCGACGCAGCCGGGCAAC
AACAACGCCGTGACGACGACGAGGTCGGGTGGCCTCGCTGCCCCGACCAAGGTTCCGGCTGCCAATGGTGTGGCC
TTTGCCGTTGCCGTGGGCGCTCTCGCTCTTCTCTGA
Gene >Ophio5|5344
ATGCGTGCCTCTACCGCACTCATCGCCCTCGGCGCTGCCGTTGCCTCGGCCCAGTCCAACGGAGTTGGCAACTAC
TCGAGCGAGCTGGACATGCACATTGATCCCAACTCGATTGGCTCCCAGCAGCGAGGTATGTACTTCCCATTCCAG
ACCCTTGTTTGTCATGAGGCTTACGACGCTTTTCACCTAAGCTATCTGGTGTCGCGCTCAGACCAACACTTGCGG
ACTCCTCTGCGATAACAACACCAGCAAGAACAGTTGCGTCCAGGTAGGCTCGCCCCCTCCCGTTTCACAGCGTCG
TGCCGTAGATCATGTCGGCTGACGTTTTCTTTGTTCCTCTCTTTAGGAGAAGCTTGAGTACGACTGTATCTGTGC
TGCCAACAACTCGGCCCCGGCCCTGCAGTATTACCAGCAGACCATCCCCACGTTCATCTGTGAGACACTTTTCAG
CCAGTGCGACAAGCAGAACGTCGGCAACGCAGAAGGTCAGCAGTCGTGCATCACCAACATCCAGAACCTGTGCGG
CAAGGGTGCCCCGCCCAAGGTGTCGAGCGGCAGCAGCAGCGGCGGTGACAGCAGCGGCGGTGACAGCAGCGACAG
CAGCGACAGCTCCAGCACGGCCGCCTCGAGCTCGTCGCAGGCGACTGCGACGCAGCCGGGCAACAACAACGCCGT
GACGACGACGAGGTCGGGTGGCCTCGCTGCCCCGACCAAGGTTCCGGCTGCCAATGGTGTGGCCTTTGCCGTTGC
CGTGGGCGCTCTCGCTCTTCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail