Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5340
Gene name
Locationscaffold_434:3346..7179
Strand+
Gene length (bp)3833
Transcript length (bp)3168
Coding sequence length (bp)3165
Protein length (aa) 1055

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12349 Sterol-sensing Sterol-sensing domain of SREBP cleavage-activation 7.0E-35 266 407
PF02460 Patched Patched family 2.9E-12 252 401

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2RRU4|SCAP_RAT Sterol regulatory element-binding protein cleavage-activating protein OS=Rattus norvegicus GN=Scap PE=2 SV=1 220 408 2.0E-18
sp|P97260|SCAP_CRIGR Sterol regulatory element-binding protein cleavage-activating protein OS=Cricetulus griseus GN=SCAP PE=1 SV=1 220 408 2.0E-18
sp|Q6GQT6|SCAP_MOUSE Sterol regulatory element-binding protein cleavage-activating protein OS=Mus musculus GN=Scap PE=1 SV=1 220 408 3.0E-18
sp|Q5MNU5|SCAP_PIG Sterol regulatory element-binding protein cleavage-activating protein OS=Sus scrofa GN=SCAP PE=2 SV=2 220 408 4.0E-18
sp|A0JPH4|SCAP_XENLA Sterol regulatory element-binding protein cleavage-activating protein OS=Xenopus laevis GN=scap PE=2 SV=1 221 428 5.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2RRU4|SCAP_RAT Sterol regulatory element-binding protein cleavage-activating protein OS=Rattus norvegicus GN=Scap PE=2 SV=1 220 408 2.0E-18
sp|P97260|SCAP_CRIGR Sterol regulatory element-binding protein cleavage-activating protein OS=Cricetulus griseus GN=SCAP PE=1 SV=1 220 408 2.0E-18
sp|Q6GQT6|SCAP_MOUSE Sterol regulatory element-binding protein cleavage-activating protein OS=Mus musculus GN=Scap PE=1 SV=1 220 408 3.0E-18
sp|Q5MNU5|SCAP_PIG Sterol regulatory element-binding protein cleavage-activating protein OS=Sus scrofa GN=SCAP PE=2 SV=2 220 408 4.0E-18
sp|A0JPH4|SCAP_XENLA Sterol regulatory element-binding protein cleavage-activating protein OS=Xenopus laevis GN=scap PE=2 SV=1 221 428 5.0E-18
sp|Q12770|SCAP_HUMAN Sterol regulatory element-binding protein cleavage-activating protein OS=Homo sapiens GN=SCAP PE=1 SV=4 220 408 5.0E-18
sp|O43043|SCAP_SCHPO Sterol regulatory element-binding protein cleavage-activating protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scp1 PE=1 SV=1 245 684 6.0E-18
sp|A6QM06|SCAP_BOVIN Sterol regulatory element-binding protein cleavage-activating protein OS=Bos taurus GN=SCAP PE=2 SV=1 220 408 7.0E-18
sp|Q0EEE2|PTHD3_MOUSE Patched domain-containing protein 3 OS=Mus musculus GN=Ptchd3 PE=1 SV=1 192 403 8.0E-09
sp|P56941|NPC1_PIG Niemann-Pick C1 protein OS=Sus scrofa GN=NPC1 PE=2 SV=1 173 405 5.0E-08
sp|O15118|NPC1_HUMAN Niemann-Pick C1 protein OS=Homo sapiens GN=NPC1 PE=1 SV=2 238 405 2.0E-07
sp|O35604|NPC1_MOUSE Niemann-Pick C1 protein OS=Mus musculus GN=Npc1 PE=1 SV=2 238 405 9.0E-07
sp|O35595|PTC2_MOUSE Protein patched homolog 2 OS=Mus musculus GN=Ptch2 PE=2 SV=2 192 403 4.0E-06
sp|Q3KNS1|PTHD3_HUMAN Patched domain-containing protein 3 OS=Homo sapiens GN=PTCHD3 PE=1 SV=3 198 403 9.0E-06
sp|Q13635|PTC1_HUMAN Protein patched homolog 1 OS=Homo sapiens GN=PTCH1 PE=1 SV=2 238 405 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 39 61 22
2 132 151 19
3 242 259 17
4 274 296 22
5 308 330 22
6 345 367 22
7 374 396 22
8 446 465 19
9 568 590 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5340
MIWYLLYPLRGTTEAPALPSSHPLYNAFARYGRYAARHVVATLLVSAAVATVLVYPIPFLFTSDFVNGASNLPRH
VWTVAQPLLYNTAAEPDIIMRSIWVHASYMQALNTELLVSALNLQDDLLGITKNFSPASARLLVLSFAFTVLGLL
SKNQSTFANVTLRHSIVFSGKRFEERRLLAADSLVITLLHLRDSPVGRRWESRILELPQKVGNTWNIYPPDGRAA
SSQLYEFQFRPISMQDIASLALAYGLTLVYFLTSLSKLRAVKSKVGLIVTVLAQIVFSIMSSFTVCAVFNVDLSR
IPRAAYPLVVLAMSLEHIFRLINAVILTPLEDIVSNRIGQAFAETAPTAMFSTLQNVIILAGLSRLVSAGVSGFC
VFAAIAIVFDFFYLSTFFLAVLSVDVRRMELGDALAKASMRHNRNKPDTGVSRRWWWDPVLQGRIAMSTRIAGTI
VMVGFVLIAQWHFFSDEGSFRKLVRFYRDLDRDQGPGHSRSSLLDSVHQARSPTSWLRIQDHETAREVINIIKPS
SYSYVARVYDPIVFVLKNSDRVPHSKEPALLPAVYDFVNHELVRFVVVVVVVIAALRLLTSFLLWEDENLNDQHE
PDELPRLSVRSLARGHLMDVVLLTTSADGHVVSAGLDNTIRAWSIHGVGTSYVIAKGDESEMAVFPVVAMAIDDD
SKWLALLSRPKRSACSRVSFWDLQSRAWGSSIQADNRRHRPVALLFDPSAPSHQPRALVVQQDGSLSELLSGEKK
ERQFVSMFPPHLTCARLLARKEGGPQPIILAVSRQGEVHMAARDQGVWRSRRLAIGGLGEPGAHSIQVVAPLNLF
VVAAGDRAHLIDGKDGGVLQTLRTAAMLPRPLRCAYKRHPSSQLESMGLASFTLGYVEADSRDCILQTYMPPEDC
DAIYLQTPCEAWSSNWCTWESARETRKRVADPGVWEMVSDGSAVGIRFSAPGGKGLQMSGLRNRYGKRVPEPDPL
EGWQVWMESLPGCRPEESESRRLIKDGEQAGHLLVTEVGPKSRVGLNSVAFAFGDMIKLVVVGAQVIGGCECGGR
DGTGD
Coding >Ophio5|5340
ATGATCTGGTATCTTCTATACCCGCTGCGAGGAACCACGGAGGCGCCTGCGCTCCCCTCCTCGCATCCTCTGTAC
AACGCCTTTGCTCGCTATGGCCGCTACGCTGCCCGTCACGTCGTCGCGACGCTCCTCGTCTCTGCTGCCGTGGCC
ACCGTTCTCGTTTATCCCATTCCTTTCCTCTTCACTAGCGACTTCGTCAACGGCGCTTCCAACTTGCCGCGTCAT
GTCTGGACCGTCGCACAGCCACTTCTGTACAACACCGCCGCGGAGCCAGACATCATCATGCGCTCCATCTGGGTG
CATGCTAGCTATATGCAGGCTTTGAACACCGAGCTACTAGTCTCGGCCCTCAACCTCCAGGACGACCTCCTCGGC
ATCACCAAGAACTTTAGCCCCGCAAGTGCCCGGCTCTTGGTTCTTTCATTCGCCTTTACTGTATTGGGGCTGCTC
TCGAAGAATCAGTCTACGTTTGCCAATGTCACTCTTCGCCACTCCATCGTCTTCAGCGGCAAACGTTTCGAGGAA
CGCCGCTTACTGGCCGCTGATTCCCTCGTCATCACCCTGCTACATCTTCGCGACTCCCCCGTCGGTCGACGGTGG
GAGAGTCGAATACTCGAGCTGCCGCAAAAGGTAGGAAACACGTGGAATATATATCCGCCAGACGGACGGGCCGCT
TCCAGTCAACTCTACGAGTTCCAGTTTCGACCCATCTCCATGCAGGACATAGCTAGCCTCGCCCTTGCCTATGGT
CTCACCCTGGTCTACTTTCTCACAAGCTTGTCCAAGCTGAGGGCTGTCAAGTCTAAAGTCGGTCTCATTGTCACA
GTCCTGGCTCAGATTGTCTTCTCCATCATGTCCAGCTTTACGGTTTGCGCCGTCTTCAACGTCGACCTCTCCCGC
ATCCCGAGGGCAGCGTACCCCCTAGTTGTTCTGGCTATGAGCCTGGAGCACATTTTTAGACTTATCAACGCAGTC
ATTCTCACACCGTTGGAAGACATTGTGAGCAATAGGATAGGCCAAGCCTTCGCCGAAACTGCCCCGACGGCCATG
TTCAGCACCCTGCAAAACGTCATCATTCTGGCGGGCCTCTCCCGTCTGGTTTCTGCCGGGGTGTCGGGATTCTGC
GTATTTGCCGCCATTGCGATCGTATTTGATTTCTTCTACCTCAGCACCTTCTTCTTGGCCGTCTTGAGCGTCGAC
GTCCGCCGGATGGAGCTTGGTGACGCACTGGCCAAAGCCTCGATGCGGCACAATCGTAACAAGCCCGACACGGGT
GTCAGCCGACGCTGGTGGTGGGACCCGGTCTTACAAGGAAGGATCGCAATGTCGACTCGCATCGCTGGCACCATC
GTCATGGTCGGCTTCGTACTCATCGCGCAGTGGCACTTTTTCAGCGACGAGGGCTCATTCAGAAAACTTGTGCGG
TTCTACAGGGACTTGGACCGGGACCAGGGTCCCGGCCACTCGAGGTCGTCCTTGCTCGACAGTGTCCACCAAGCA
AGGAGCCCCACGTCTTGGCTGCGCATACAGGATCACGAAACAGCCCGTGAGGTCATCAACATCATCAAGCCGTCG
TCATACAGCTACGTTGCCCGCGTCTACGATCCGATTGTCTTTGTGTTGAAAAACTCGGACCGCGTGCCGCACAGT
AAAGAGCCTGCCCTGCTACCGGCAGTGTACGATTTCGTCAATCACGAATTGGTCCGCTTCGTTGTCGTCGTCGTC
GTCGTCATTGCGGCTCTCCGTTTGCTGACCAGCTTCCTACTGTGGGAGGACGAGAATCTCAATGACCAACACGAG
CCAGATGAGCTTCCGCGGCTTTCCGTCAGGTCCCTGGCCAGGGGCCACCTCATGGATGTCGTGTTACTGACAACG
TCCGCGGATGGTCATGTCGTGTCCGCCGGGCTTGACAACACGATTCGAGCATGGTCGATACACGGCGTAGGAACG
AGCTACGTGATCGCAAAAGGCGACGAATCGGAAATGGCCGTGTTTCCGGTGGTGGCAATGGCGATTGACGACGAT
TCAAAGTGGCTCGCCTTGTTGTCGAGGCCGAAAAGGAGTGCCTGCTCCAGGGTCAGCTTCTGGGACCTGCAGAGC
AGAGCTTGGGGTTCGTCGATCCAGGCCGACAACCGCCGACACAGGCCGGTGGCTCTCTTGTTTGACCCCAGCGCG
CCCAGCCACCAGCCGAGGGCGCTTGTCGTCCAGCAGGACGGCTCGTTGAGTGAGTTGTTGTCGGGCGAGAAGAAG
GAGCGGCAATTTGTTTCCATGTTTCCTCCGCATCTGACATGCGCCCGCCTGCTGGCCAGAAAGGAAGGCGGTCCG
CAGCCGATCATCTTGGCAGTATCGCGGCAGGGCGAGGTCCACATGGCTGCTCGAGATCAGGGAGTCTGGCGATCT
CGACGACTCGCGATCGGGGGCCTGGGAGAGCCCGGCGCTCATTCGATACAGGTCGTGGCTCCGTTGAATCTGTTC
GTCGTGGCGGCAGGCGACCGTGCTCATCTTATCGACGGCAAAGATGGTGGCGTGCTGCAAACGCTACGAACAGCA
GCGATGCTACCACGGCCTCTGAGATGCGCATACAAACGCCACCCTTCTTCGCAGCTCGAGTCGATGGGTTTGGCG
TCCTTCACTCTTGGTTACGTGGAGGCCGATTCCCGGGATTGCATCCTGCAGACGTACATGCCACCGGAAGATTGT
GACGCTATTTACTTGCAGACGCCGTGCGAGGCTTGGAGCAGCAACTGGTGCACGTGGGAGTCGGCAAGGGAGACG
CGAAAGCGCGTAGCGGACCCGGGTGTGTGGGAGATGGTTTCTGACGGCAGCGCAGTGGGAATACGGTTTAGTGCT
CCTGGTGGCAAGGGATTACAGATGTCGGGTTTGCGGAATCGGTACGGCAAAAGGGTTCCAGAGCCAGACCCGCTC
GAGGGCTGGCAGGTCTGGATGGAGTCGTTACCGGGTTGTCGGCCTGAAGAGAGCGAAAGTCGCCGTCTGATCAAG
GACGGTGAGCAAGCCGGGCACCTACTGGTAACGGAGGTGGGGCCGAAATCGAGAGTTGGGCTGAACTCGGTCGCG
TTTGCGTTTGGCGACATGATCAAGCTCGTCGTCGTCGGGGCACAGGTTATAGGTGGTTGCGAATGTGGTGGCAGG
GACGGGACGGGGGAT
Transcript >Ophio5|5340
ATGATCTGGTATCTTCTATACCCGCTGCGAGGAACCACGGAGGCGCCTGCGCTCCCCTCCTCGCATCCTCTGTAC
AACGCCTTTGCTCGCTATGGCCGCTACGCTGCCCGTCACGTCGTCGCGACGCTCCTCGTCTCTGCTGCCGTGGCC
ACCGTTCTCGTTTATCCCATTCCTTTCCTCTTCACTAGCGACTTCGTCAACGGCGCTTCCAACTTGCCGCGTCAT
GTCTGGACCGTCGCACAGCCACTTCTGTACAACACCGCCGCGGAGCCAGACATCATCATGCGCTCCATCTGGGTG
CATGCTAGCTATATGCAGGCTTTGAACACCGAGCTACTAGTCTCGGCCCTCAACCTCCAGGACGACCTCCTCGGC
ATCACCAAGAACTTTAGCCCCGCAAGTGCCCGGCTCTTGGTTCTTTCATTCGCCTTTACTGTATTGGGGCTGCTC
TCGAAGAATCAGTCTACGTTTGCCAATGTCACTCTTCGCCACTCCATCGTCTTCAGCGGCAAACGTTTCGAGGAA
CGCCGCTTACTGGCCGCTGATTCCCTCGTCATCACCCTGCTACATCTTCGCGACTCCCCCGTCGGTCGACGGTGG
GAGAGTCGAATACTCGAGCTGCCGCAAAAGGTAGGAAACACGTGGAATATATATCCGCCAGACGGACGGGCCGCT
TCCAGTCAACTCTACGAGTTCCAGTTTCGACCCATCTCCATGCAGGACATAGCTAGCCTCGCCCTTGCCTATGGT
CTCACCCTGGTCTACTTTCTCACAAGCTTGTCCAAGCTGAGGGCTGTCAAGTCTAAAGTCGGTCTCATTGTCACA
GTCCTGGCTCAGATTGTCTTCTCCATCATGTCCAGCTTTACGGTTTGCGCCGTCTTCAACGTCGACCTCTCCCGC
ATCCCGAGGGCAGCGTACCCCCTAGTTGTTCTGGCTATGAGCCTGGAGCACATTTTTAGACTTATCAACGCAGTC
ATTCTCACACCGTTGGAAGACATTGTGAGCAATAGGATAGGCCAAGCCTTCGCCGAAACTGCCCCGACGGCCATG
TTCAGCACCCTGCAAAACGTCATCATTCTGGCGGGCCTCTCCCGTCTGGTTTCTGCCGGGGTGTCGGGATTCTGC
GTATTTGCCGCCATTGCGATCGTATTTGATTTCTTCTACCTCAGCACCTTCTTCTTGGCCGTCTTGAGCGTCGAC
GTCCGCCGGATGGAGCTTGGTGACGCACTGGCCAAAGCCTCGATGCGGCACAATCGTAACAAGCCCGACACGGGT
GTCAGCCGACGCTGGTGGTGGGACCCGGTCTTACAAGGAAGGATCGCAATGTCGACTCGCATCGCTGGCACCATC
GTCATGGTCGGCTTCGTACTCATCGCGCAGTGGCACTTTTTCAGCGACGAGGGCTCATTCAGAAAACTTGTGCGG
TTCTACAGGGACTTGGACCGGGACCAGGGTCCCGGCCACTCGAGGTCGTCCTTGCTCGACAGTGTCCACCAAGCA
AGGAGCCCCACGTCTTGGCTGCGCATACAGGATCACGAAACAGCCCGTGAGGTCATCAACATCATCAAGCCGTCG
TCATACAGCTACGTTGCCCGCGTCTACGATCCGATTGTCTTTGTGTTGAAAAACTCGGACCGCGTGCCGCACAGT
AAAGAGCCTGCCCTGCTACCGGCAGTGTACGATTTCGTCAATCACGAATTGGTCCGCTTCGTTGTCGTCGTCGTC
GTCGTCATTGCGGCTCTCCGTTTGCTGACCAGCTTCCTACTGTGGGAGGACGAGAATCTCAATGACCAACACGAG
CCAGATGAGCTTCCGCGGCTTTCCGTCAGGTCCCTGGCCAGGGGCCACCTCATGGATGTCGTGTTACTGACAACG
TCCGCGGATGGTCATGTCGTGTCCGCCGGGCTTGACAACACGATTCGAGCATGGTCGATACACGGCGTAGGAACG
AGCTACGTGATCGCAAAAGGCGACGAATCGGAAATGGCCGTGTTTCCGGTGGTGGCAATGGCGATTGACGACGAT
TCAAAGTGGCTCGCCTTGTTGTCGAGGCCGAAAAGGAGTGCCTGCTCCAGGGTCAGCTTCTGGGACCTGCAGAGC
AGAGCTTGGGGTTCGTCGATCCAGGCCGACAACCGCCGACACAGGCCGGTGGCTCTCTTGTTTGACCCCAGCGCG
CCCAGCCACCAGCCGAGGGCGCTTGTCGTCCAGCAGGACGGCTCGTTGAGTGAGTTGTTGTCGGGCGAGAAGAAG
GAGCGGCAATTTGTTTCCATGTTTCCTCCGCATCTGACATGCGCCCGCCTGCTGGCCAGAAAGGAAGGCGGTCCG
CAGCCGATCATCTTGGCAGTATCGCGGCAGGGCGAGGTCCACATGGCTGCTCGAGATCAGGGAGTCTGGCGATCT
CGACGACTCGCGATCGGGGGCCTGGGAGAGCCCGGCGCTCATTCGATACAGGTCGTGGCTCCGTTGAATCTGTTC
GTCGTGGCGGCAGGCGACCGTGCTCATCTTATCGACGGCAAAGATGGTGGCGTGCTGCAAACGCTACGAACAGCA
GCGATGCTACCACGGCCTCTGAGATGCGCATACAAACGCCACCCTTCTTCGCAGCTCGAGTCGATGGGTTTGGCG
TCCTTCACTCTTGGTTACGTGGAGGCCGATTCCCGGGATTGCATCCTGCAGACGTACATGCCACCGGAAGATTGT
GACGCTATTTACTTGCAGACGCCGTGCGAGGCTTGGAGCAGCAACTGGTGCACGTGGGAGTCGGCAAGGGAGACG
CGAAAGCGCGTAGCGGACCCGGGTGTGTGGGAGATGGTTTCTGACGGCAGCGCAGTGGGAATACGGTTTAGTGCT
CCTGGTGGCAAGGGATTACAGATGTCGGGTTTGCGGAATCGGTACGGCAAAAGGGTTCCAGAGCCAGACCCGCTC
GAGGGCTGGCAGGTCTGGATGGAGTCGTTACCGGGTTGTCGGCCTGAAGAGAGCGAAAGTCGCCGTCTGATCAAG
GACGGTGAGCAAGCCGGGCACCTACTGGTAACGGAGGTGGGGCCGAAATCGAGAGTTGGGCTGAACTCGGTCGCG
TTTGCGTTTGGCGACATGATCAAGCTCGTCGTCGTCGGGGCACAGGTTATAGGTGGTTGCGAATGTGGTGGCAGG
GACGGGACGGGGGATTGA
Gene >Ophio5|5340
ATGATCTGGTATCTTCTATACCCGCTGCGAGGGTGAGCAGTGACTCTTTTTGCTCTCTGCCCTGTATCCTATTCC
CGAGTCTTGGGGAGCAGCCGTATTTTTGCCCTGGTCCGGAGCTAACTTTCTACCGTGTTTCCAGAACCACGGAGG
CGCCTGCGCTCCCCTCCTCGCATCCTCTGTACAACGCCTTTGCTCGCTATGGCCGCTACGCTGCCCGTCACGTCG
TCGCGACGCTCCTCGTCTCTGCTGCCGTGGCCACCGTTCTCGTTTATCCCATTCCTTTCCTCTTCACTAGCGACT
TCGTCAACGGCGCTTCCAACTTGCCGCGTCATGTCTGGACCGTCGCACAGCCACTTCTGTACAACACCGCCGCGG
AGCCAGACATCATCATGCGCTCCATCTGGGTGCATGCTAGCTATATGCAGGCTTTGAACACCGAGCTACTAGTCT
CGGCCCTCAACCTCCAGGACGACCTCCTCGGCATCACCAAGAACTTTAGCCCCGCAAGTGCCCGGCGTACGCCTC
CTTGGACCGACTTACCCAACGAGGATTTGTCGTTGAGCCAGCGAGATGCAATTCATGTCGCTAATGGTCTGACTT
CGCAGTCTTGGTTCTTTCATTCGCCTTTACTGTATTGGGGCTGCTCTCGTGAGCGCATCTTGGCCGACGACGATA
TCCTCTCAACCGTCAATAATAGGAAGAATCAGTCTACGTTTGCCAATGTCACTCTTCGCCACTCCATCGTCTTCA
GCGGCAAACGTTTCGAGGAACGCCGCTTACTGGCCGCTGATTCCCTCGTCATCACCCTGCTACATCTTCGCGACT
CCCCCGTCGGTCGACGGTGGGAGAGTCGAATACTCGAGCTGCCGCAAAAGGTAGGAAACACGTGGAATATATATC
CGCCAGACGGACGGGCCGCTTCCAGTCAACTCTACGAGTTCCAGTTTCGACCCATCTCCATGCAGGACATAGCTA
GCCTCGCCCTTGCCTATGGTCTCACCCTGGTCTACTTTCTCACAAGCTTGTCCAAGCTGAGGGCTGTCAAGTCTA
AAGTCGGTCTCATTGTCACAGTCCTGGCTCAGATTGTCTTCTCCATCATGTCCAGCTTTACGGTTTGCGCCGTCT
TCAACGTCGACCTCTCCCGCATCCCGAGGGCAGCGTACCCCCTAGTTGTTCTGGCTATGAGCCTGGAGCACATTT
TTAGACTTATCAACGCAGTCATTCTCACACCGTTGGAAGACATTGTGAGCAATAGGATAGGCCAAGCCTTCGCCG
AAACTGCCCCGACGGCCATGTTCAGCACCCTGCAAAACGTCATCATTCTGGCGGGCCTCTCCCGTCTGGTTTCTG
CCGGGGTGTCGGGATTCTGCGTATTTGCCGCCATTGCGATCGTATTTGATTTCTTCTACCTCAGCACCTTCTTCT
TGGCCGTCTTGAGCGTCGACGTCCGCCGGATGGAGCTTGGTGACGCACTGGCCAAAGCCTCGATGCGGCACAATC
GTAACAAGCCCGACACGGGTGTCAGCCGACGCTGGTGGTGGGACCCGGTCTTACAAGGAAGGATCGCAATGTCGA
CTCGCATCGCTGGCACCATCGTCATGGTCGGCTTCGTACTCATCGCGCAGTGGCACTTTTTCAGCGACGAGGGCT
CATTCAGAAAACTTGTGCGGTTCTACAGGGACTTGGACCGGGACCAGGGTCCCGGCCACTCGAGGTCGTCCTTGC
TCGACAGTGTCCACCAAGCAAGGAGCCCCACGTCTTGGCTGCGCATACAGGATCACGAAACAGCCCGTGAGGTCA
TCAACATCATCAAGCCGTCGTCATACAGCTACGTTGCCCGCGTCTACGATCCGATTGTCTTTGTGTTGAAAAACT
CGGACCGCGTGCCGCACAGTAAAGAGCCTGCCCTGCTACCGGCAGTGTACGATTTCGTCAATCACGAATTGGTCC
GCTTCGTTGTCGTCGTCGTCGTCGTCATTGCGGCTCTCCGTTTGCTGACCAGCTTCCTACTGTGGGAGGACGAGA
ATCTCAATGACCAACACGAGCCAGATGAGCTTCCGCGGCTTTCCGTCAGGTCCCTGGCCAGGGGCCACCTCATGG
ATGTCGTGTTACTGACAACGTCCGCGGATGGTCATGTCGTGTCCGCCGGGCTTGACAACACGATTCGAGCATGGT
CGATACACGGCGTAGGAACGAGCTACGTGATCGCAAAAGGCGACGAATCGGAAATGGCCGTGTTTCCGGTGGTGG
CAATGGCGATTGACGACGATTCAAAGTGGCTCGCCTTGTTGTCGAGGCCGAAAAGGAGTGCCTGCTCCAGGGTCA
GCTTCTGGGACCTGCAGAGCAGAGCTTGGGGTTCGTCGATCCAGGCCGACAACCGCCGACACAGGCCGGTGGCTC
TCTTGTTTGACCCCAGCGCGCCCAGCCACCAGCCGAGGGCGCTTGTCGTCCAGCAGGACGGCTCGTTGAGTGAGT
TGTTGTCGGGCGAGAAGAAGGAGCGGCAATTTGTTTCCATGTTTCCTCCGCATCTGACATGCGCCCGCCTGCTGG
CCAGAAAGGGTAAAATGACACCAATTGGGCTCTCGAGCCATGTCCCAAAAAACTTGTTGGCTGCAGAGTGCGCTG
ATCATCATGTCATCTCTCTAGAAGGCGGTCCGCAGCCGATCATCTTGGCAGTATCGCGGCAGGGCGAGGTCCACA
TGGCTGCTCGAGATCAGGGAGTCTGGCGATCTCGACGACTCGCGATCGGGGGCCTGGGAGAGCCCGGCGCTCATT
CGATACAGGTCGTGGCTCCGTTGAATCTGTTCGTCGTGGCGGCAGGCGACCGTGCTCATCTTATCGACGGCAAAG
ATGGTGGCGTGCTGCAAACGCTACGAACAGCAGCGATGCTACCACGGCCTCTGAGATGCGCATACAAACGCCACC
CTTCTTCGCAGCTCGAGTCGATGGGTTTGGCGTCCTTCACTCTTGGTTACGTGGAGGCCGATTCCCGGGATTGCA
TCCTGCAGACGTACATGCCACCGGAAGATTGTGACGCTATTTACTTGCAGACGCCGTGCGAGGCTTGGAGCAGCA
ACTGGTGCACGTGGGAGTCGGCAAGGGAGACGCGAAAGCGCGTAGCGGACCCGGGTGTGTGGGAGATGGTTTCTG
ACGGCAGCGCAGTGGGAATACGGTTTAGTGCTCCTGGTGGCAAGGGATTACAGATGTCGGGTTTGCGGAATCGGT
ACGGCAAAAGGGTTCCAGAGCCAGACCCGCTCGAGGGCTGGCAGGTCTGGATGGAGTCGTTACCGGGTTGTCGGC
CTGAAGAGAGCGAAAGTCGCCGTCTGATCAAGGACGGTGAGCAAGCCGGGCACCTACTGGTAACGGAGGTGGGGC
CGAAATCGAGAGTTGGGCTGAACTCGGTCGCGTTTGCGTTTGGCGACATGATCAAGCTCGTCGTCGTCGGGGCAC
AGGTGCGTCTCAAGGGGAGGTCCGAGGGCCAGGCTGGCGAGGCGTTGATGAGCGCTGGGAGCAGACGGCGGAGGC
CAGGATCCGTCTTGAGGGGGCGAGCTGCGTCCCGAGGCTAGGTAGGTCTGGCTGGTAGCATGTGTGCGAAGGAGA
CGGCAATTGGACCGGCATCAAGGTTATAGGTAAGCTCTGCGTGACAGTGACGCTGTAAAGCATGGCTACCTACAC
CTACCTACCTACCTACCTACCTATATGGCCTGTATGCCCATGTCGTCCTGATTCGTCATGACTTGTTGAAGATTA
CAAGATGGTCAACGGACCAACCTGACTGACAACCATGCATAGGTGGTTGCGAATGTGGTGGCAGGGACGGGACGG
GGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail