Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5337
Gene name
Locationscaffold_433:16711..18037
Strand+
Gene length (bp)1326
Transcript length (bp)1326
Coding sequence length (bp)1323
Protein length (aa) 441

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00246 Peptidase_M14 Zinc carboxypeptidase 1.4E-35 83 380

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VL86|CBPA1_DROME Zinc carboxypeptidase A 1 OS=Drosophila melanogaster GN=CG17633 PE=2 SV=1 59 294 1.0E-15
sp|Q29NC4|CBPA1_DROPS Zinc carboxypeptidase A 1 OS=Drosophila pseudoobscura pseudoobscura GN=GA14587 PE=3 SV=1 87 291 2.0E-14
sp|P55261|CBPB1_CANLF Carboxypeptidase B OS=Canis lupus familiaris GN=CPB1 PE=2 SV=1 83 299 3.0E-14
sp|P19223|CBPB1_RAT Carboxypeptidase B OS=Rattus norvegicus GN=Cpb1 PE=1 SV=1 83 299 4.0E-14
sp|P04069|CBPB_ASTAS Carboxypeptidase B OS=Astacus astacus PE=1 SV=1 82 369 5.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VL86|CBPA1_DROME Zinc carboxypeptidase A 1 OS=Drosophila melanogaster GN=CG17633 PE=2 SV=1 59 294 1.0E-15
sp|Q29NC4|CBPA1_DROPS Zinc carboxypeptidase A 1 OS=Drosophila pseudoobscura pseudoobscura GN=GA14587 PE=3 SV=1 87 291 2.0E-14
sp|P55261|CBPB1_CANLF Carboxypeptidase B OS=Canis lupus familiaris GN=CPB1 PE=2 SV=1 83 299 3.0E-14
sp|P19223|CBPB1_RAT Carboxypeptidase B OS=Rattus norvegicus GN=Cpb1 PE=1 SV=1 83 299 4.0E-14
sp|P04069|CBPB_ASTAS Carboxypeptidase B OS=Astacus astacus PE=1 SV=1 82 369 5.0E-14
sp|Q8IVL8|CBPO_HUMAN Carboxypeptidase O OS=Homo sapiens GN=CPO PE=2 SV=1 82 304 2.0E-13
sp|Q8N4T0|CBPA6_HUMAN Carboxypeptidase A6 OS=Homo sapiens GN=CPA6 PE=1 SV=2 79 367 3.0E-13
sp|P42788|CBPZ_SIMVI Zinc carboxypeptidase (Fragment) OS=Simulium vittatum PE=2 SV=1 79 297 1.0E-12
sp|Q9EQV9|CBPB2_RAT Carboxypeptidase B2 OS=Rattus norvegicus GN=Cpb2 PE=2 SV=1 79 371 1.0E-12
sp|Q9JHH6|CBPB2_MOUSE Carboxypeptidase B2 OS=Mus musculus GN=Cpb2 PE=1 SV=1 79 371 2.0E-12
sp|P19222|CBPA2_RAT Carboxypeptidase A2 OS=Rattus norvegicus GN=Cpa2 PE=1 SV=1 119 299 4.0E-12
sp|Q5U901|CBPA6_MOUSE Carboxypeptidase A6 OS=Mus musculus GN=Cpa6 PE=2 SV=1 79 288 5.0E-12
sp|Q504N0|CBPA2_MOUSE Carboxypeptidase A2 OS=Mus musculus GN=Cpa2 PE=1 SV=1 119 311 2.0E-11
sp|P15086|CBPB1_HUMAN Carboxypeptidase B OS=Homo sapiens GN=CPB1 PE=1 SV=4 58 288 2.0E-11
sp|B6H233|ECM14_PENRW Putative metallocarboxypeptidase ecm14 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=ecm14 PE=3 SV=1 72 288 2.0E-11
sp|P15088|CBPA3_HUMAN Mast cell carboxypeptidase A OS=Homo sapiens GN=CPA3 PE=1 SV=2 82 291 5.0E-11
sp|B8M2K0|ECM14_TALSN Putative metallocarboxypeptidase ecm14 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=ecm14 PE=3 SV=1 94 305 6.0E-11
sp|O02350|CBPA1_ANOGA Zinc carboxypeptidase A 1 OS=Anopheles gambiae GN=AGAP009593 PE=2 SV=3 79 304 8.0E-11
sp|Q6P8K8|CBPA4_MOUSE Carboxypeptidase A4 OS=Mus musculus GN=Cpa4 PE=2 SV=2 65 291 9.0E-11
sp|Q0II73|CBPO_BOVIN Carboxypeptidase O OS=Bos taurus GN=CPO PE=2 SV=1 82 304 1.0E-10
sp|P48052|CBPA2_HUMAN Carboxypeptidase A2 OS=Homo sapiens GN=CPA2 PE=1 SV=3 69 299 2.0E-10
sp|Q5B011|ECM14_EMENI Putative metallocarboxypeptidase ecm14 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ecm14 PE=3 SV=2 72 288 5.0E-10
sp|P21961|CBPA3_RAT Mast cell carboxypeptidase A (Fragment) OS=Rattus norvegicus GN=Cpa3 PE=1 SV=2 82 291 1.0E-09
sp|Q2KIG3|CBPB2_BOVIN Carboxypeptidase B2 OS=Bos taurus GN=CPB2 PE=1 SV=1 79 299 1.0E-09
sp|P00732|CBPB1_BOVIN Carboxypeptidase B OS=Bos taurus GN=CPB1 PE=1 SV=2 83 293 2.0E-09
sp|Q9UI42|CBPA4_HUMAN Carboxypeptidase A4 OS=Homo sapiens GN=CPA4 PE=1 SV=2 68 299 2.0E-09
sp|D4B5N0|MCPAL_ARTBC Metallocarboxypeptidase A-like protein ARB_03789 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03789 PE=3 SV=1 87 281 2.0E-09
sp|P15089|CBPA3_MOUSE Mast cell carboxypeptidase A OS=Mus musculus GN=Cpa3 PE=2 SV=1 82 291 3.0E-09
sp|P18143|CBPS_STRGR Zinc carboxypeptidase OS=Streptomyces griseus GN=scpD PE=1 SV=2 82 291 5.0E-09
sp|Q0C9B4|ECM14_ASPTN Putative metallocarboxypeptidase ecm14 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ecm14 PE=3 SV=1 107 306 5.0E-09
sp|P38836|ECM14_YEAST Putative metallocarboxypeptidase ECM14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM14 PE=1 SV=1 66 323 6.0E-09
sp|P00730|CBPA1_BOVIN Carboxypeptidase A1 OS=Bos taurus GN=CPA1 PE=1 SV=3 68 301 8.0E-09
sp|Q96IY4|CBPB2_HUMAN Carboxypeptidase B2 OS=Homo sapiens GN=CPB2 PE=1 SV=2 79 299 8.0E-09
sp|D4D675|MCPAL_TRIVH Metallocarboxypeptidase A-like protein TRV_02598 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_02598 PE=3 SV=1 87 281 1.0E-08
sp|Q8R4H4|CBPA5_MOUSE Carboxypeptidase A5 OS=Mus musculus GN=Cpa5 PE=2 SV=1 68 304 1.0E-08
sp|P15085|CBPA1_HUMAN Carboxypeptidase A1 OS=Homo sapiens GN=CPA1 PE=1 SV=2 68 291 2.0E-08
sp|B6Q972|ECM14_TALMQ Putative metallocarboxypeptidase ecm14 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=ecm14 PE=3 SV=1 90 305 2.0E-08
sp|B8NBP9|ECM14_ASPFN Putative metallocarboxypeptidase ecm14 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=ecm14 PE=3 SV=1 87 288 2.0E-08
sp|Q2TZK2|ECM14_ASPOR Putative metallocarboxypeptidase ecm14 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ecm14 PE=3 SV=1 87 288 2.0E-08
sp|O74818|YBJ7_SCHPO Uncharacterized carboxypeptidase C337.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC337.07c PE=3 SV=1 66 326 2.0E-08
sp|P00731|CBPA1_RAT Carboxypeptidase A1 OS=Rattus norvegicus GN=Cpa1 PE=2 SV=2 68 299 3.0E-08
sp|P09955|CBPB1_PIG Carboxypeptidase B OS=Sus scrofa GN=CPB1 PE=1 SV=5 83 299 4.0E-08
sp|E5A0U8|ECM14_LEPMJ Putative metallocarboxypeptidase ECM14 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=ECM14 PE=3 SV=1 107 305 5.0E-08
sp|Q4X1U0|ECM14_ASPFU Putative metallocarboxypeptidase ecm14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ecm14 PE=3 SV=1 107 288 1.0E-07
sp|B0XRS8|ECM14_ASPFC Putative metallocarboxypeptidase ecm14 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=ecm14 PE=3 SV=1 107 288 1.0E-07
sp|C5G6U8|ECM14_AJEDR Putative metallocarboxypeptidase ECM14 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=ECM14 PE=3 SV=1 72 288 2.0E-07
sp|C5JZS0|ECM14_AJEDS Putative metallocarboxypeptidase ECM14 OS=Ajellomyces dermatitidis (strain SLH14081) GN=ECM14 PE=3 SV=1 72 288 2.0E-07
sp|B6V865|MCPA_TRITO Metallocarboxypeptidase A OS=Trichophyton tonsurans GN=MCPA PE=3 SV=1 85 225 4.0E-07
sp|B8XGR3|MCPA_TRIEQ Metallocarboxypeptidase A OS=Trichophyton equinum GN=MCPA PE=3 SV=1 85 225 4.0E-07
sp|E4UPZ6|ECM14_ARTGP Putative metallocarboxypeptidase ECM14 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=ECM14 PE=3 SV=1 107 291 5.0E-07
sp|D4AKU7|ECM14_ARTBC Putative metallocarboxypeptidase ECM14 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ECM14 PE=3 SV=1 107 291 6.0E-07
sp|D4DIW7|ECM14_TRIVH Putative metallocarboxypeptidase ECM14 OS=Trichophyton verrucosum (strain HKI 0517) GN=ECM14 PE=3 SV=1 107 291 8.0E-07
sp|Q8WXQ8|CBPA5_HUMAN Carboxypeptidase A5 OS=Homo sapiens GN=CPA5 PE=2 SV=1 68 291 8.0E-07
sp|P39041|CBPS_STRMP Zinc carboxypeptidase OS=Saccharothrix mutabilis subsp. capreolus PE=3 SV=1 63 225 1.0E-06
sp|Q4R7R2|CBPA5_MACFA Carboxypeptidase A5 OS=Macaca fascicularis GN=CPA5 PE=2 SV=1 107 291 1.0E-06
sp|A6XGK3|MCPA_TRIRU Metallocarboxypeptidase A OS=Trichophyton rubrum GN=MCPA PE=1 SV=1 85 225 2.0E-06
sp|D4DL57|MCPA_TRIVH Probable metallocarboxypeptidase A OS=Trichophyton verrucosum (strain HKI 0517) GN=MCPA PE=3 SV=1 85 225 2.0E-06
sp|D4AS12|MCPA_ARTBC Probable metallocarboxypeptidase A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=MCPA PE=1 SV=2 85 225 2.0E-06
sp|C5FPR9|ECM14_ARTOC Putative metallocarboxypeptidase ECM14 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=ECM14 PE=3 SV=1 107 291 2.0E-06
sp|A1DGH9|ECM14_NEOFI Putative metallocarboxypeptidase ecm14 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ecm14 PE=3 SV=1 107 288 2.0E-06
sp|P29068|CBPT_THEVU Carboxypeptidase T OS=Thermoactinomyces vulgaris GN=cpt PE=1 SV=1 82 291 2.0E-06
sp|A2QZA2|ECM14_ASPNC Putative metallocarboxypeptidase ecm14 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ecm14 PE=3 SV=1 90 288 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0004181 metallocarboxypeptidase activity Yes
GO:0006508 proteolysis Yes
GO:0004180 carboxypeptidase activity No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0046872 metal ion binding No
GO:0008238 exopeptidase activity No
GO:0008152 metabolic process No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008233 peptidase activity No
GO:0071704 organic substance metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0008235 metalloexopeptidase activity No
GO:0008237 metallopeptidase activity No
GO:0019538 protein metabolic process No
GO:0046914 transition metal ion binding No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5337
MKPATIILLATHFALYTSGYLNPDEGDAGSTIVHQQPSIEEMTTAGVSYFPVGRGDRFRNVVPRGFGSTADFEAA
SILSVTEIESALQGLQKTYPDKMMLNTTGIKTHEGRDIFVAVMGSDSPRVLLVSGIHGRDRGGPDNLVYLMSDLL
WADRNNASLHYDSKEYSIDQVRQILAAGIALIPSANPDGLNYDQTTNSCWRKNRRPATNRKEVGVDINVNFNVFW
DFENMFHQNTTKIAMSRDARKQNYVGPEPLSEPETRSIYNLLRDMTSLSWYLDLHSVRGEVLYSWGDDSSQTEDP
SMNHLNATYNRQRGIPDDAYREYLEPEDFYAQKSVAERMVEVMNSVGDEAFYQAAESASLYASPGSTDEAMAKYY
SRKCGANRINVVRLNFGKEVDTLICQDFFYPDAHKYHQNLLQTTVGLMEFLLNAAGQAGERKLYHC
Coding >Ophio5|5337
ATGAAACCAGCAACTATTATTCTTCTTGCTACACATTTTGCTCTCTACACCAGCGGCTACCTTAATCCTGACGAG
GGAGATGCAGGAAGTACCATTGTCCACCAGCAGCCATCCATCGAGGAGATGACCACGGCCGGGGTTAGCTACTTT
CCTGTCGGCAGAGGCGATCGCTTCCGGAATGTCGTACCCCGGGGATTCGGCTCAACGGCCGACTTTGAAGCCGCT
TCTATCCTGAGCGTCACTGAGATCGAATCGGCTCTCCAGGGCCTTCAGAAGACTTACCCTGATAAGATGATGCTT
AATACGACGGGTATCAAAACACACGAGGGCCGAGACATCTTCGTCGCCGTCATGGGCTCTGATAGCCCCCGTGTT
CTCCTTGTTAGTGGCATACACGGTCGTGATCGTGGAGGGCCGGACAATCTTGTTTATCTCATGTCGGACCTCCTC
TGGGCTGATAGGAACAACGCCAGTCTTCATTATGACAGCAAAGAATACAGCATTGACCAAGTGCGACAGATTCTT
GCCGCTGGCATCGCCTTGATTCCTTCGGCCAACCCAGACGGACTGAACTACGATCAAACGACCAACTCGTGCTGG
CGTAAGAACCGCCGTCCCGCGACGAATCGGAAAGAAGTCGGCGTCGATATCAACGTCAACTTCAACGTCTTCTGG
GACTTTGAGAACATGTTCCATCAGAATACGACCAAGATAGCCATGTCCCGAGATGCCAGAAAGCAAAACTACGTT
GGACCGGAACCCCTATCCGAGCCCGAGACACGAAGCATCTACAATCTTCTCCGGGATATGACGTCCTTGTCATGG
TACTTGGACCTGCATTCCGTTCGAGGCGAGGTGCTATACTCATGGGGCGATGATTCTTCCCAGACGGAGGATCCC
TCGATGAACCATCTCAACGCGACATACAACCGGCAGCGTGGTATTCCGGATGATGCGTACAGAGAGTATCTGGAG
CCAGAAGATTTCTACGCTCAAAAGTCGGTCGCCGAACGCATGGTCGAGGTCATGAACAGCGTCGGCGATGAAGCA
TTCTACCAAGCGGCCGAATCGGCATCACTCTACGCCTCACCCGGCAGCACAGACGAAGCCATGGCCAAATACTAT
AGCCGGAAATGCGGCGCCAATCGTATCAACGTCGTGAGGTTGAATTTCGGAAAGGAGGTCGATACGCTCATTTGT
CAGGACTTCTTTTACCCTGACGCCCATAAATATCATCAGAATCTCCTGCAGACAACTGTCGGCTTGATGGAGTTT
CTACTCAATGCAGCAGGCCAGGCTGGCGAGAGAAAGCTTTACCACTGT
Transcript >Ophio5|5337
ATGAAACCAGCAACTATTATTCTTCTTGCTACACATTTTGCTCTCTACACCAGCGGCTACCTTAATCCTGACGAG
GGAGATGCAGGAAGTACCATTGTCCACCAGCAGCCATCCATCGAGGAGATGACCACGGCCGGGGTTAGCTACTTT
CCTGTCGGCAGAGGCGATCGCTTCCGGAATGTCGTACCCCGGGGATTCGGCTCAACGGCCGACTTTGAAGCCGCT
TCTATCCTGAGCGTCACTGAGATCGAATCGGCTCTCCAGGGCCTTCAGAAGACTTACCCTGATAAGATGATGCTT
AATACGACGGGTATCAAAACACACGAGGGCCGAGACATCTTCGTCGCCGTCATGGGCTCTGATAGCCCCCGTGTT
CTCCTTGTTAGTGGCATACACGGTCGTGATCGTGGAGGGCCGGACAATCTTGTTTATCTCATGTCGGACCTCCTC
TGGGCTGATAGGAACAACGCCAGTCTTCATTATGACAGCAAAGAATACAGCATTGACCAAGTGCGACAGATTCTT
GCCGCTGGCATCGCCTTGATTCCTTCGGCCAACCCAGACGGACTGAACTACGATCAAACGACCAACTCGTGCTGG
CGTAAGAACCGCCGTCCCGCGACGAATCGGAAAGAAGTCGGCGTCGATATCAACGTCAACTTCAACGTCTTCTGG
GACTTTGAGAACATGTTCCATCAGAATACGACCAAGATAGCCATGTCCCGAGATGCCAGAAAGCAAAACTACGTT
GGACCGGAACCCCTATCCGAGCCCGAGACACGAAGCATCTACAATCTTCTCCGGGATATGACGTCCTTGTCATGG
TACTTGGACCTGCATTCCGTTCGAGGCGAGGTGCTATACTCATGGGGCGATGATTCTTCCCAGACGGAGGATCCC
TCGATGAACCATCTCAACGCGACATACAACCGGCAGCGTGGTATTCCGGATGATGCGTACAGAGAGTATCTGGAG
CCAGAAGATTTCTACGCTCAAAAGTCGGTCGCCGAACGCATGGTCGAGGTCATGAACAGCGTCGGCGATGAAGCA
TTCTACCAAGCGGCCGAATCGGCATCACTCTACGCCTCACCCGGCAGCACAGACGAAGCCATGGCCAAATACTAT
AGCCGGAAATGCGGCGCCAATCGTATCAACGTCGTGAGGTTGAATTTCGGAAAGGAGGTCGATACGCTCATTTGT
CAGGACTTCTTTTACCCTGACGCCCATAAATATCATCAGAATCTCCTGCAGACAACTGTCGGCTTGATGGAGTTT
CTACTCAATGCAGCAGGCCAGGCTGGCGAGAGAAAGCTTTACCACTGTTGA
Gene >Ophio5|5337
ATGAAACCAGCAACTATTATTCTTCTTGCTACACATTTTGCTCTCTACACCAGCGGCTACCTTAATCCTGACGAG
GGAGATGCAGGAAGTACCATTGTCCACCAGCAGCCATCCATCGAGGAGATGACCACGGCCGGGGTTAGCTACTTT
CCTGTCGGCAGAGGCGATCGCTTCCGGAATGTCGTACCCCGGGGATTCGGCTCAACGGCCGACTTTGAAGCCGCT
TCTATCCTGAGCGTCACTGAGATCGAATCGGCTCTCCAGGGCCTTCAGAAGACTTACCCTGATAAGATGATGCTT
AATACGACGGGTATCAAAACACACGAGGGCCGAGACATCTTCGTCGCCGTCATGGGCTCTGATAGCCCCCGTGTT
CTCCTTGTTAGTGGCATACACGGTCGTGATCGTGGAGGGCCGGACAATCTTGTTTATCTCATGTCGGACCTCCTC
TGGGCTGATAGGAACAACGCCAGTCTTCATTATGACAGCAAAGAATACAGCATTGACCAAGTGCGACAGATTCTT
GCCGCTGGCATCGCCTTGATTCCTTCGGCCAACCCAGACGGACTGAACTACGATCAAACGACCAACTCGTGCTGG
CGTAAGAACCGCCGTCCCGCGACGAATCGGAAAGAAGTCGGCGTCGATATCAACGTCAACTTCAACGTCTTCTGG
GACTTTGAGAACATGTTCCATCAGAATACGACCAAGATAGCCATGTCCCGAGATGCCAGAAAGCAAAACTACGTT
GGACCGGAACCCCTATCCGAGCCCGAGACACGAAGCATCTACAATCTTCTCCGGGATATGACGTCCTTGTCATGG
TACTTGGACCTGCATTCCGTTCGAGGCGAGGTGCTATACTCATGGGGCGATGATTCTTCCCAGACGGAGGATCCC
TCGATGAACCATCTCAACGCGACATACAACCGGCAGCGTGGTATTCCGGATGATGCGTACAGAGAGTATCTGGAG
CCAGAAGATTTCTACGCTCAAAAGTCGGTCGCCGAACGCATGGTCGAGGTCATGAACAGCGTCGGCGATGAAGCA
TTCTACCAAGCGGCCGAATCGGCATCACTCTACGCCTCACCCGGCAGCACAGACGAAGCCATGGCCAAATACTAT
AGCCGGAAATGCGGCGCCAATCGTATCAACGTCGTGAGGTTGAATTTCGGAAAGGAGGTCGATACGCTCATTTGT
CAGGACTTCTTTTACCCTGACGCCCATAAATATCATCAGAATCTCCTGCAGACAACTGTCGGCTTGATGGAGTTT
CTACTCAATGCAGCAGGCCAGGCTGGCGAGAGAAAGCTTTACCACTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail