Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5326
Gene name
Locationscaffold_432:8726..9835
Strand-
Gene length (bp)1109
Transcript length (bp)1002
Coding sequence length (bp)999
Protein length (aa) 333

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00397 WW WW domain 1.4E-08 141 169

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14097|YERE_SCHPO WW domain-containing protein C2F3.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2F3.14c PE=1 SV=1 247 329 1.0E-15

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5326
MPGEIVVPHSAGGTSTTSISSQNLFFPGSRSPNTRRRTPPCPVQEFASCLGPTPNGFLPPMSSPPGTHASGSATP
SVAEASDVKDVAPATEAVLPCPDPTEHLKVTAESEQAEKQSAAVPEETSDDGPPLPDEPVPQDKDDGWDCLWEPT
HQKWYFVNRFTGVSQWENPRVPDAAVSSSAEAQPAASLNEKPAAGGYNPAIHGDYDPNAWYAQAYNQEQEQQQQM
QDAAAAAAAAAAAAFGDPAGAYGTTVGFNRFTGQFQAPGAGPQRHSDEAKARRQMNAFFDVDAAANAHDGRSLKA
ERQNQKLSKSELKAYKEKRRAKKEEKRRAWLMD
Coding >Ophio5|5326
ATGCCCGGGGAAATTGTAGTTCCGCATTCCGCGGGCGGCACTTCAACCACCTCCATATCCTCGCAGAACCTCTTC
TTTCCAGGATCTCGCTCGCCCAACACACGCCGACGAACGCCGCCTTGTCCAGTCCAGGAGTTTGCCAGCTGCCTT
GGCCCGACCCCCAACGGATTCTTGCCACCAATGTCCTCGCCGCCAGGAACCCACGCGTCCGGTTCGGCGACGCCG
TCCGTCGCCGAGGCGTCGGACGTGAAAGATGTCGCGCCTGCGACCGAGGCAGTCCTCCCGTGTCCGGACCCGACA
GAGCATCTCAAGGTTACGGCTGAAAGCGAGCAGGCCGAGAAACAGTCTGCGGCCGTCCCTGAGGAGACATCGGAC
GATGGACCTCCCTTACCTGATGAGCCGGTGCCACAGGACAAAGACGACGGTTGGGACTGCTTGTGGGAGCCGACG
CATCAGAAATGGTATTTTGTCAATCGCTTCACTGGCGTGAGCCAGTGGGAGAATCCTCGCGTCCCCGACGCCGCT
GTCTCCTCCTCCGCAGAAGCGCAGCCCGCTGCATCCTTGAACGAGAAGCCAGCTGCGGGAGGCTATAACCCGGCT
ATTCATGGCGACTACGACCCTAACGCGTGGTACGCTCAGGCCTACAATCAGGAACAAGAACAGCAGCAGCAGATG
CAAGATGCGGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCTTTCGGTGACCCCGCTGGCGCATACGGCACTACA
GTCGGCTTCAATCGCTTCACCGGGCAGTTTCAAGCCCCCGGCGCCGGCCCGCAACGCCACAGCGATGAGGCCAAG
GCCAGACGCCAGATGAATGCCTTTTTCGACGTCGATGCCGCCGCCAACGCGCACGATGGCCGCAGCCTCAAAGCG
GAGCGTCAGAATCAGAAGCTCAGTAAGTCCGAACTCAAGGCTTACAAAGAGAAGCGACGCGCCAAAAAGGAAGAG
AAACGTAGAGCTTGGCTTATGGAT
Transcript >Ophio5|5326
ATGCCCGGGGAAATTGTAGTTCCGCATTCCGCGGGCGGCACTTCAACCACCTCCATATCCTCGCAGAACCTCTTC
TTTCCAGGATCTCGCTCGCCCAACACACGCCGACGAACGCCGCCTTGTCCAGTCCAGGAGTTTGCCAGCTGCCTT
GGCCCGACCCCCAACGGATTCTTGCCACCAATGTCCTCGCCGCCAGGAACCCACGCGTCCGGTTCGGCGACGCCG
TCCGTCGCCGAGGCGTCGGACGTGAAAGATGTCGCGCCTGCGACCGAGGCAGTCCTCCCGTGTCCGGACCCGACA
GAGCATCTCAAGGTTACGGCTGAAAGCGAGCAGGCCGAGAAACAGTCTGCGGCCGTCCCTGAGGAGACATCGGAC
GATGGACCTCCCTTACCTGATGAGCCGGTGCCACAGGACAAAGACGACGGTTGGGACTGCTTGTGGGAGCCGACG
CATCAGAAATGGTATTTTGTCAATCGCTTCACTGGCGTGAGCCAGTGGGAGAATCCTCGCGTCCCCGACGCCGCT
GTCTCCTCCTCCGCAGAAGCGCAGCCCGCTGCATCCTTGAACGAGAAGCCAGCTGCGGGAGGCTATAACCCGGCT
ATTCATGGCGACTACGACCCTAACGCGTGGTACGCTCAGGCCTACAATCAGGAACAAGAACAGCAGCAGCAGATG
CAAGATGCGGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCTTTCGGTGACCCCGCTGGCGCATACGGCACTACA
GTCGGCTTCAATCGCTTCACCGGGCAGTTTCAAGCCCCCGGCGCCGGCCCGCAACGCCACAGCGATGAGGCCAAG
GCCAGACGCCAGATGAATGCCTTTTTCGACGTCGATGCCGCCGCCAACGCGCACGATGGCCGCAGCCTCAAAGCG
GAGCGTCAGAATCAGAAGCTCAGTAAGTCCGAACTCAAGGCTTACAAAGAGAAGCGACGCGCCAAAAAGGAAGAG
AAACGTAGAGCTTGGCTTATGGATTGA
Gene >Ophio5|5326
ATGCCCGGGGAAATTGTAGTTCCGCATTCCGCGGGCGGCACTTCAACCACCTCCATATCCTCGCAGAACCTCTTC
TTTCCGTAAGCCTGCTTCACCTTGGGACAACAGCGCTCAGACAGAGGATCTCGCTCGCCCAACACACGCCGACGA
ACGCCGCCTTGTCCAGTCCAGGTGCCTACATTGAGTATTTGATTGAAAATGGCCCCGTTTCTACGATGCTCATAC
TTTTACGCCGACAGGAGTTTGCCAGCTGCCTTGGCCCGACCCCCAACGGATTCTTGCCACCAATGTCCTCGCCGC
CAGGAACCCACGCGTCCGGTTCGGCGACGCCGTCCGTCGCCGAGGCGTCGGACGTGAAAGATGTCGCGCCTGCGA
CCGAGGCAGTCCTCCCGTGTCCGGACCCGACAGAGCATCTCAAGGTTACGGCTGAAAGCGAGCAGGCCGAGAAAC
AGTCTGCGGCCGTCCCTGAGGAGACATCGGACGATGGACCTCCCTTACCTGATGAGCCGGTGCCACAGGACAAAG
ACGACGGTTGGGACTGCTTGTGGGAGCCGACGCATCAGAAATGGTATTTTGTCAATCGCTTCACTGGCGTGAGCC
AGTGGGAGAATCCTCGCGTCCCCGACGCCGCTGTCTCCTCCTCCGCAGAAGCGCAGCCCGCTGCATCCTTGAACG
AGAAGCCAGCTGCGGGAGGCTATAACCCGGCTATTCATGGCGACTACGACCCTAACGCGTGGTACGCTCAGGCCT
ACAATCAGGAACAAGAACAGCAGCAGCAGATGCAAGATGCGGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCTT
TCGGTGACCCCGCTGGCGCATACGGCACTACAGTCGGCTTCAATCGCTTCACCGGGCAGTTTCAAGCCCCCGGCG
CCGGCCCGCAACGCCACAGCGATGAGGCCAAGGCCAGACGCCAGATGAATGCCTTTTTCGACGTCGATGCCGCCG
CCAACGCGCACGATGGCCGCAGCCTCAAAGCGGAGCGTCAGAATCAGAAGCTCAGTAAGTCCGAACTCAAGGCTT
ACAAAGAGAAGCGACGCGCCAAAAAGGAAGAGAAACGTAGAGCTTGGCTTATGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail