Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5325
Gene name
Locationscaffold_432:5811..8213
Strand+
Gene length (bp)2402
Transcript length (bp)2286
Coding sequence length (bp)2283
Protein length (aa) 761

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08167 RIX1 rRNA processing/ribosome biogenesis 6.2E-61 9 216

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P87243|RIX1_SCHPO Pre-rRNA-processing protein rix1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rix1 PE=1 SV=1 49 273 6.0E-16

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2335 0.9253 0.1345 0.0135 0.0844 0.0065 0.0696 0.0121 0.0335 0.0023

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3429
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3449
Ophiocordyceps australis map64 (Brazil) OphauB2|6880
Ophiocordyceps camponoti-floridani Ophcf2|07093
Ophiocordyceps camponoti-rufipedis Ophun1|7058
Ophiocordyceps kimflemingae Ophio5|5325 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6510

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5325
MSSPPPLDLQVLCRKLSSIPTNQLPRALPALTRHVARCGRALSTTPQDQKRPKDDNTSRTTLLVHKLKTTITTLL
IGRSADARFAAVGLIKAVVDVGGWETLRGAEPWVRGLLSIVQRGDSLATKEMAVVTLTRIYTLLQPFQTLIREIA
TPTIPAFATACLQLIKPTASASPASIVETICDAFAILIPHYPTTFRPFATQIRSAVRVYLAPTNSDATFLVTHSL
QRAASRLVVSLHHVVAKSGSCEDWAKMVGVVIRELHATADQVLRAVDEAWYSSDGYVRTAVNPDGEPSGGSAAPD
QLPPWTGLSAGVERLIGLFTHLADYLMCPTRGSVAVPLSAIMGAISRVGLIAKPSSKSQDWHQFLETNPAIGREE
KEELWSLIPQVHVAAMDLATVMIQRFQQGLVPLVSEMLDNLVRIFKSGMDMPATRQSGYHLLAAILSIAGPTLSK
QAVAAVEPLMAACCRDLQQDAGLLKPDDRPAAPDSKKKGVANADLFLRPSASTSAVGDVVLDTDHRAAAERLLPL
LFSSLPQQNLKASLRSLVDKTAILTRNRDAMLASVLHPYRDRRGRIYPSILPHLTRQYPHDQGLEQKTAYEMDQG
GIEDGDDAVEDETEQQNPGEMTKEENQAETSPKPGTAKQSPTAAIPAAEPESKPFASIAPPSKAARLDLPPPKRK
HDGSSAAHAPKRHEAAKPAKASNPNLSKPDEVEGAESVVDTITVAPLPLPPPSLPVDEDDDSDESVHLNMELDDD
EAGELEDEVDG
Coding >Ophio5|5325
ATGTCGTCCCCTCCGCCGCTGGACCTTCAGGTTCTCTGCAGGAAGCTCTCTTCCATCCCAACGAATCAGCTCCCA
CGAGCTCTCCCTGCTCTTACGAGACATGTGGCCCGCTGCGGTCGTGCCCTGTCGACGACGCCTCAGGACCAGAAG
AGGCCCAAGGACGACAACACCTCTCGAACAACGCTCCTGGTCCACAAGCTCAAAACTACCATCACCACGCTTTTG
ATCGGCCGGAGCGCTGATGCGAGATTCGCTGCCGTCGGCTTGATCAAGGCAGTTGTCGACGTCGGAGGTTGGGAG
ACGCTCCGCGGCGCCGAGCCTTGGGTTCGCGGACTGCTTTCAATTGTCCAGAGAGGTGATTCCCTTGCTACCAAG
GAGATGGCAGTCGTCACCCTGACGCGAATATACACTTTACTCCAACCTTTTCAGACACTGATCAGGGAGATTGCC
ACTCCAACGATACCAGCTTTTGCCACGGCATGTCTCCAACTCATCAAGCCGACGGCATCCGCATCTCCAGCATCC
ATCGTCGAGACGATTTGCGATGCGTTTGCCATCCTGATTCCCCACTATCCAACCACGTTTCGCCCCTTTGCGACA
CAAATTCGCTCGGCCGTGAGAGTTTATCTGGCGCCGACCAACTCTGACGCAACTTTCCTAGTCACTCACTCCCTG
CAACGCGCCGCTAGCCGGCTCGTCGTCTCCCTACACCATGTCGTCGCCAAGTCCGGCAGCTGCGAGGATTGGGCC
AAGATGGTGGGCGTCGTCATACGCGAGCTGCATGCTACAGCCGATCAAGTCCTACGTGCTGTGGATGAGGCCTGG
TATTCGTCGGACGGCTACGTGCGCACCGCTGTAAACCCCGATGGCGAGCCCAGCGGCGGATCTGCTGCGCCCGAC
CAACTGCCTCCGTGGACCGGCCTGAGTGCGGGCGTCGAGCGCTTGATCGGATTGTTTACTCACTTGGCAGACTAC
CTGATGTGCCCGACTAGGGGTTCCGTTGCCGTTCCCCTGAGTGCCATCATGGGCGCGATATCGAGGGTTGGCTTG
ATCGCAAAGCCGTCTTCCAAATCGCAAGATTGGCATCAGTTTCTGGAGACAAACCCGGCCATCGGCAGAGAAGAG
AAGGAGGAGCTATGGAGTCTCATTCCCCAAGTCCACGTGGCGGCCATGGACCTAGCCACGGTGATGATTCAACGG
TTCCAGCAGGGTTTGGTCCCCCTGGTATCCGAGATGCTGGATAACCTGGTGCGCATCTTCAAGTCCGGCATGGAC
ATGCCAGCGACTCGCCAAAGCGGTTATCACCTCCTCGCCGCCATCCTCTCCATAGCGGGACCGACCTTGTCGAAA
CAGGCGGTAGCCGCCGTCGAGCCCCTGATGGCAGCCTGCTGCCGGGACCTGCAACAAGACGCAGGCCTCCTCAAG
CCCGACGACAGACCCGCCGCCCCAGACTCGAAAAAGAAGGGCGTCGCCAACGCCGACCTCTTCCTTCGGCCATCT
GCCTCAACCAGCGCGGTGGGAGACGTCGTGCTCGATACCGACCACAGAGCGGCGGCTGAGCGTCTTCTCCCCCTC
TTGTTTTCGAGCCTGCCGCAGCAGAACCTGAAAGCCAGCCTGCGCAGCCTCGTCGACAAGACGGCCATTCTGACT
CGCAATCGCGACGCCATGCTGGCCAGCGTGCTGCATCCTTATCGTGACCGCCGCGGACGCATCTACCCCAGCATC
CTCCCTCACTTGACGCGACAGTATCCGCACGATCAGGGATTGGAGCAGAAGACGGCATACGAGATGGACCAAGGT
GGCATTGAAGACGGAGATGACGCAGTCGAAGACGAGACAGAGCAGCAAAACCCGGGAGAAATGACGAAAGAAGAA
AACCAGGCCGAGACCAGCCCCAAGCCCGGCACCGCCAAGCAAAGCCCTACAGCCGCCATCCCCGCCGCTGAACCC
GAAAGCAAACCATTCGCAAGTATAGCGCCGCCGTCGAAAGCCGCCCGCCTAGATCTTCCACCACCCAAACGCAAG
CACGACGGGTCCTCGGCTGCCCATGCTCCCAAGCGGCACGAGGCCGCGAAGCCCGCCAAAGCTTCAAATCCAAAT
CTATCCAAGCCAGACGAGGTCGAGGGAGCAGAATCCGTCGTCGATACTATCACTGTAGCCCCCCTTCCTTTACCT
CCTCCTTCTCTTCCGGTCGACGAGGATGATGACTCCGACGAGAGCGTCCATCTCAACATGGAGCTGGACGACGAT
GAGGCCGGAGAGCTGGAGGATGAAGTGGATGGG
Transcript >Ophio5|5325
ATGTCGTCCCCTCCGCCGCTGGACCTTCAGGTTCTCTGCAGGAAGCTCTCTTCCATCCCAACGAATCAGCTCCCA
CGAGCTCTCCCTGCTCTTACGAGACATGTGGCCCGCTGCGGTCGTGCCCTGTCGACGACGCCTCAGGACCAGAAG
AGGCCCAAGGACGACAACACCTCTCGAACAACGCTCCTGGTCCACAAGCTCAAAACTACCATCACCACGCTTTTG
ATCGGCCGGAGCGCTGATGCGAGATTCGCTGCCGTCGGCTTGATCAAGGCAGTTGTCGACGTCGGAGGTTGGGAG
ACGCTCCGCGGCGCCGAGCCTTGGGTTCGCGGACTGCTTTCAATTGTCCAGAGAGGTGATTCCCTTGCTACCAAG
GAGATGGCAGTCGTCACCCTGACGCGAATATACACTTTACTCCAACCTTTTCAGACACTGATCAGGGAGATTGCC
ACTCCAACGATACCAGCTTTTGCCACGGCATGTCTCCAACTCATCAAGCCGACGGCATCCGCATCTCCAGCATCC
ATCGTCGAGACGATTTGCGATGCGTTTGCCATCCTGATTCCCCACTATCCAACCACGTTTCGCCCCTTTGCGACA
CAAATTCGCTCGGCCGTGAGAGTTTATCTGGCGCCGACCAACTCTGACGCAACTTTCCTAGTCACTCACTCCCTG
CAACGCGCCGCTAGCCGGCTCGTCGTCTCCCTACACCATGTCGTCGCCAAGTCCGGCAGCTGCGAGGATTGGGCC
AAGATGGTGGGCGTCGTCATACGCGAGCTGCATGCTACAGCCGATCAAGTCCTACGTGCTGTGGATGAGGCCTGG
TATTCGTCGGACGGCTACGTGCGCACCGCTGTAAACCCCGATGGCGAGCCCAGCGGCGGATCTGCTGCGCCCGAC
CAACTGCCTCCGTGGACCGGCCTGAGTGCGGGCGTCGAGCGCTTGATCGGATTGTTTACTCACTTGGCAGACTAC
CTGATGTGCCCGACTAGGGGTTCCGTTGCCGTTCCCCTGAGTGCCATCATGGGCGCGATATCGAGGGTTGGCTTG
ATCGCAAAGCCGTCTTCCAAATCGCAAGATTGGCATCAGTTTCTGGAGACAAACCCGGCCATCGGCAGAGAAGAG
AAGGAGGAGCTATGGAGTCTCATTCCCCAAGTCCACGTGGCGGCCATGGACCTAGCCACGGTGATGATTCAACGG
TTCCAGCAGGGTTTGGTCCCCCTGGTATCCGAGATGCTGGATAACCTGGTGCGCATCTTCAAGTCCGGCATGGAC
ATGCCAGCGACTCGCCAAAGCGGTTATCACCTCCTCGCCGCCATCCTCTCCATAGCGGGACCGACCTTGTCGAAA
CAGGCGGTAGCCGCCGTCGAGCCCCTGATGGCAGCCTGCTGCCGGGACCTGCAACAAGACGCAGGCCTCCTCAAG
CCCGACGACAGACCCGCCGCCCCAGACTCGAAAAAGAAGGGCGTCGCCAACGCCGACCTCTTCCTTCGGCCATCT
GCCTCAACCAGCGCGGTGGGAGACGTCGTGCTCGATACCGACCACAGAGCGGCGGCTGAGCGTCTTCTCCCCCTC
TTGTTTTCGAGCCTGCCGCAGCAGAACCTGAAAGCCAGCCTGCGCAGCCTCGTCGACAAGACGGCCATTCTGACT
CGCAATCGCGACGCCATGCTGGCCAGCGTGCTGCATCCTTATCGTGACCGCCGCGGACGCATCTACCCCAGCATC
CTCCCTCACTTGACGCGACAGTATCCGCACGATCAGGGATTGGAGCAGAAGACGGCATACGAGATGGACCAAGGT
GGCATTGAAGACGGAGATGACGCAGTCGAAGACGAGACAGAGCAGCAAAACCCGGGAGAAATGACGAAAGAAGAA
AACCAGGCCGAGACCAGCCCCAAGCCCGGCACCGCCAAGCAAAGCCCTACAGCCGCCATCCCCGCCGCTGAACCC
GAAAGCAAACCATTCGCAAGTATAGCGCCGCCGTCGAAAGCCGCCCGCCTAGATCTTCCACCACCCAAACGCAAG
CACGACGGGTCCTCGGCTGCCCATGCTCCCAAGCGGCACGAGGCCGCGAAGCCCGCCAAAGCTTCAAATCCAAAT
CTATCCAAGCCAGACGAGGTCGAGGGAGCAGAATCCGTCGTCGATACTATCACTGTAGCCCCCCTTCCTTTACCT
CCTCCTTCTCTTCCGGTCGACGAGGATGATGACTCCGACGAGAGCGTCCATCTCAACATGGAGCTGGACGACGAT
GAGGCCGGAGAGCTGGAGGATGAAGTGGATGGGTGA
Gene >Ophio5|5325
ATGTCGTCCCCTCCGCCGCTGGACCTTCAGGTTCTCTGCAGGAAGCTCTCTTCCATCCCAACGAATCAGCTCCCA
CGAGCTCTCCCTGCTCTTACGAGACATGTGGCCCGCTGCGGTCGTGCCCTGTCGACGACGCCTCAGGACCAGAAG
AGGCCCAAGGACGACAACACCTCTCGAACAACGCTCCTGGTCCACAAGCTCAAAACTACCATCACCACGCTTTTG
ATCGGCCGGAGCGCTGATGCGAGATTCGCTGCCGTCGGCTTGATCAAGGCAGTTGTCGACGTCGGAGGTTGGGAG
ACGCTCCGCGGCGCCGAGCCTTGGGTTCGCGGACTGCTTTCAATTGTCCAGGTAACCTTGATAGGGCCCCTTTCT
TACCGCTAGAATCCTATCTCATTGACTCGAAAAGAGAGGTGATTCCCTTGCTACCAAGGAGATGGCAGTCGTCAC
CCTGACGCGAATATACACTTTACTCCAACCTTTTCAGACACTGATCAGGGAGATTGCCACTCCAACGATACCAGC
TTTTGCCACGGCATGTCTCCAACTCATCAAGCCGACGGCATCCGCATCTCCAGCATCCATCGTCGAGACGATTTG
CGATGCGTTTGCCATCCTGATTCCCCACTATCCAACCACGTTTCGCCCCTTTGCGACACAAATTCGCTCGGCCGT
GAGAGTTTATCTGGCGCCGACCAACTCTGACGCAACTTTCCTAGTCACTCACTCCCTGCAACGCGCCGCTAGCCG
GCTCGTCGTCTCCCTACACCATGTCGTCGCCAAGTCCGGCAGCTGCGAGGATTGGGCCAAGATGGTGGGCGTCGT
CATACGCGAGCTGCATGCTACAGCCGATCAAGTCCTACGTGCTGTGGATGAGGCCTGGTATTCGTCGGACGGCTA
CGTGCGCACCGCTGTAAACCCCGATGGCGAGCCCAGCGGCGGATCTGCTGCGCCCGACCAACTGCCTCCGTGGAC
CGGCCTGAGTGCGGGCGTCGAGCGCTTGATCGGATTGTTTACTCACTTGGCAGACTACCTGATGTGCCCGACTAG
GGGTTCCGTTGCCGTTCCCCTGAGTGCCATCATGGGCGCGATATCGAGGGTTGGCTTGATCGCAAAGCCGTCTTC
CAAATCGCAAGATTGGCATCAGTTTCTGGAGACAAACCCGGCCATCGGCAGAGAAGAGAAGGAGGAGCTATGGAG
TCTCATTCCCCAAGTCCACGTGGCGGCCATGGACCTAGCCACGGTGATGATTCAACGGTTCCAGCAGGGTTTGGT
CCCCCTGGTATCCGAGATGCTGGATAACCTGGTGCGCATCTTCAAGTCCGGCATGGACATGCCAGCGACTCGCCA
AAGCGGTTATCACCTCCTCGCCGCCATCCTCTCCATAGCGGGACCGACCTTGTCGAAACAGGCGGTAGCCGCCGT
CGAGCCCCTGATGGCAGCCTGCTGCCGGGACCTGCAACAAGACGCAGGCCTCCTCAAGCCCGACGACAGACCCGC
CGCCCCAGACTCGAAAAAGAAGGGCGTCGCCAACGCCGACCTCTTCCTTCGGCCATCTGCCTCAACCAGCGCGGT
GGGAGACGTCGTGCTCGATACCGACCACAGAGCGGCGGCTGAGCGTCTTCTCCCCCTCTTGTTTTCGAGCCTGCC
GCAGCAGAACCTGAAAGCCAGCCTGCGCAGCCTCGTCGACAAGACGGCCATTCTGACTCGCAATCGCGACGCCAT
GCTGGCCAGCGTGCTGCATCCTTATCGTGACCGCCGCGGACGCATCTACCCCAGCATCCTCCCTCACTTGACGCG
ACAGTATCCGCACGATCAGGGATTGGAGGTGATTCGCACCAATCTGCGGGTTGGTAGCCGAGTAGCAGGGAGCAC
CCTTCTCGCAGCAGAAGACGGCATACGAGATGGACCAAGGTGGCATTGAAGACGGAGATGACGCAGTCGAAGACG
AGACAGAGCAGCAAAACCCGGGAGAAATGACGAAAGAAGAAAACCAGGCCGAGACCAGCCCCAAGCCCGGCACCG
CCAAGCAAAGCCCTACAGCCGCCATCCCCGCCGCTGAACCCGAAAGCAAACCATTCGCAAGTATAGCGCCGCCGT
CGAAAGCCGCCCGCCTAGATCTTCCACCACCCAAACGCAAGCACGACGGGTCCTCGGCTGCCCATGCTCCCAAGC
GGCACGAGGCCGCGAAGCCCGCCAAAGCTTCAAATCCAAATCTATCCAAGCCAGACGAGGTCGAGGGAGCAGAAT
CCGTCGTCGATACTATCACTGTAGCCCCCCTTCCTTTACCTCCTCCTTCTCTTCCGGTCGACGAGGATGATGACT
CCGACGAGAGCGTCCATCTCAACATGGAGCTGGACGACGATGAGGCCGGAGAGCTGGAGGATGAAGTGGATGGGT
GA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail