Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5314
Gene name
Locationscaffold_430:8847..9622
Strand+
Gene length (bp)775
Transcript length (bp)444
Coding sequence length (bp)441
Protein length (aa) 147

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01198 Ribosomal_L31e Ribosomal protein L31e 4.2E-40 42 123

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0C2H8|RL31A_YEAST 60S ribosomal protein L31-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL31A PE=1 SV=1 38 147 3.0E-48
sp|P0C2H9|RL31B_YEAST 60S ribosomal protein L31-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL31B PE=1 SV=1 38 147 3.0E-48
sp|Q6FWF4|RL31_CANGA 60S ribosomal protein L31 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPL31 PE=3 SV=1 38 147 7.0E-48
sp|Q9XGL4|RL31_CYAPA 60S ribosomal protein L31 OS=Cyanophora paradoxa GN=RPL31 PE=3 SV=1 31 142 7.0E-47
sp|Q9IA76|RL31_PAROL 60S ribosomal protein L31 OS=Paralichthys olivaceus GN=rpl31 PE=2 SV=1 28 147 2.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0C2H8|RL31A_YEAST 60S ribosomal protein L31-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL31A PE=1 SV=1 38 147 3.0E-48
sp|P0C2H9|RL31B_YEAST 60S ribosomal protein L31-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL31B PE=1 SV=1 38 147 3.0E-48
sp|Q6FWF4|RL31_CANGA 60S ribosomal protein L31 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPL31 PE=3 SV=1 38 147 7.0E-48
sp|Q9XGL4|RL31_CYAPA 60S ribosomal protein L31 OS=Cyanophora paradoxa GN=RPL31 PE=3 SV=1 31 142 7.0E-47
sp|Q9IA76|RL31_PAROL 60S ribosomal protein L31 OS=Paralichthys olivaceus GN=rpl31 PE=2 SV=1 28 147 2.0E-45
sp|Q90YT7|RL31_ICTPU 60S ribosomal protein L31 OS=Ictalurus punctatus GN=rpl31 PE=2 SV=1 37 147 3.0E-45
sp|Q6NUH0|RL31_XENLA 60S ribosomal protein L31 OS=Xenopus laevis GN=rpl31 PE=2 SV=1 37 147 1.0E-43
sp|P62902|RL31_RAT 60S ribosomal protein L31 OS=Rattus norvegicus GN=Rpl31 PE=2 SV=1 37 147 3.0E-43
sp|P62901|RL31_PIG 60S ribosomal protein L31 OS=Sus scrofa GN=RPL31 PE=1 SV=1 37 147 3.0E-43
sp|P62900|RL31_MOUSE 60S ribosomal protein L31 OS=Mus musculus GN=Rpl31 PE=1 SV=1 37 147 3.0E-43
sp|Q1KSC7|RL31_MARMO 60S ribosomal protein L31 OS=Marmota monax GN=RPL31 PE=2 SV=1 37 147 3.0E-43
sp|P62899|RL31_HUMAN 60S ribosomal protein L31 OS=Homo sapiens GN=RPL31 PE=1 SV=1 37 147 3.0E-43
sp|Q56JX3|RL31_BOVIN 60S ribosomal protein L31 OS=Bos taurus GN=RPL31 PE=2 SV=1 37 147 3.0E-43
sp|Q5RBR9|RL31_PONAB 60S ribosomal protein L31 OS=Pongo abelii GN=RPL31 PE=2 SV=1 37 146 2.0E-42
sp|Q757D7|RL31_ASHGO 60S ribosomal protein L31 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPL31 PE=3 SV=2 38 147 8.0E-42
sp|Q9M573|RL31_PERFR 60S ribosomal protein L31 OS=Perilla frutescens GN=RPL31 PE=2 SV=1 42 147 6.0E-41
sp|O65071|RL31_PICMA 60S ribosomal protein L31 OS=Picea mariana GN=RPL31 PE=2 SV=1 33 147 1.0E-40
sp|P45841|RL31_CHLRE 60S ribosomal protein L31 OS=Chlamydomonas reinhardtii GN=RPL31 PE=3 SV=1 44 147 4.0E-39
sp|Q9STR1|RL312_ARATH 60S ribosomal protein L31-2 OS=Arabidopsis thaliana GN=RPL31B PE=3 SV=1 42 147 8.0E-38
sp|Q9SLL7|RL311_ARATH 60S ribosomal protein L31-1 OS=Arabidopsis thaliana GN=RPL31A PE=3 SV=1 42 147 2.0E-37
sp|P51420|RL313_ARATH 60S ribosomal protein L31-3 OS=Arabidopsis thaliana GN=RPL31C PE=2 SV=2 42 147 3.0E-37
sp|Q54XB5|RL31_DICDI 60S ribosomal protein L31 OS=Dictyostelium discoideum GN=rpl31 PE=3 SV=1 41 142 5.0E-37
sp|Q9URX6|RL31_SCHPO 60S ribosomal protein L31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl31 PE=3 SV=1 33 147 5.0E-37
sp|Q9GP16|RL31_HELVI 60S ribosomal protein L31 OS=Heliothis virescens GN=RpL31 PE=2 SV=1 30 142 9.0E-37
sp|Q7KF90|RL31_SPOFR 60S ribosomal protein L31 OS=Spodoptera frugiperda GN=RpL31 PE=2 SV=1 30 142 9.0E-37
sp|Q9V597|RL31_DROME 60S ribosomal protein L31 OS=Drosophila melanogaster GN=RpL31 PE=1 SV=1 23 146 8.0E-33
sp|P46290|RL31_NICGU 60S ribosomal protein L31 OS=Nicotiana glutinosa GN=RPL31 PE=2 SV=1 42 147 1.0E-31
sp|Q9MAV7|RL31_PANGI 60S ribosomal protein L31 OS=Panax ginseng GN=RPL31 PE=2 SV=1 42 147 5.0E-31
sp|Q22DH9|RL31_TETTS 60S ribosomal protein L31 OS=Tetrahymena thermophila (strain SB210) GN=RPL31 PE=1 SV=1 49 142 1.0E-30
sp|Q9GN74|RL31_AEDAE 60S ribosomal protein L31 OS=Aedes aegypti GN=RpL31 PE=2 SV=1 38 146 1.0E-28
sp|Q9U332|RL31_CAEEL 60S ribosomal protein L31 OS=Caenorhabditis elegans GN=rpl-31 PE=3 SV=1 34 146 1.0E-28
sp|O18602|RL31_DROVI 60S ribosomal protein L31 OS=Drosophila virilis GN=RpL31 PE=3 SV=1 28 146 2.0E-28
sp|P54009|RL31_METJA 50S ribosomal protein L31e OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl31e PE=3 SV=1 46 110 3.0E-09
sp|A6UR55|RL31_METVS 50S ribosomal protein L31e OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl31e PE=3 SV=1 46 110 1.0E-08
sp|Q8TUY4|RL31_METKA 50S ribosomal protein L31e OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl31e PE=3 SV=1 40 110 1.0E-08
sp|A9A8N0|RL31_METM6 50S ribosomal protein L31e OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl31e PE=3 SV=1 46 111 3.0E-08
sp|Q6M155|RL31_METMP 50S ribosomal protein L31e OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl31e PE=3 SV=1 46 111 4.0E-08
sp|A6VI49|RL31_METM7 50S ribosomal protein L31e OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl31e PE=3 SV=1 46 111 5.0E-08
sp|Q8U3S7|RL31_PYRFU 50S ribosomal protein L31e OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl31e PE=1 SV=1 48 111 1.0E-07
sp|A4G0C8|RL31_METM5 50S ribosomal protein L31e OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl31e PE=3 SV=1 46 111 1.0E-07
sp|A3CWZ5|RL31_METMJ 50S ribosomal protein L31e OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rpl31e PE=3 SV=1 63 110 2.0E-07
sp|A6UT96|RL31_META3 50S ribosomal protein L31e OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl31e PE=3 SV=1 46 111 2.0E-07
sp|B8GEU5|RL31_METPE 50S ribosomal protein L31e OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rpl31e PE=3 SV=1 63 110 3.0E-07
sp|A7I9I7|RL31_METB6 50S ribosomal protein L31e OS=Methanoregula boonei (strain 6A8) GN=rpl31e PE=3 SV=1 63 110 1.0E-06
sp|Q9UYI7|RL31_PYRAB 50S ribosomal protein L31e OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl31e PE=3 SV=1 48 129 2.0E-06
sp|B6YWY3|RL31_THEON 50S ribosomal protein L31e OS=Thermococcus onnurineus (strain NA1) GN=rpl31e PE=3 SV=1 48 126 3.0E-06
sp|A8A968|RL31_IGNH4 50S ribosomal protein L31e OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rpl31e PE=3 SV=1 48 136 6.0E-06
sp|O27649|RL31_METTH 50S ribosomal protein L31e OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl31e PE=3 SV=1 64 110 7.0E-06
sp|Q2FS98|RL31_METHJ 50S ribosomal protein L31e OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl31e PE=3 SV=1 63 110 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005840 ribosome Yes
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0006518 peptide metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0043226 organelle No
GO:1901576 organic substance biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0044238 primary metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043228 non-membrane-bounded organelle No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009058 biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0043603 cellular amide metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019538 protein metabolic process No
GO:0043229 intracellular organelle No
GO:0009059 macromolecule biosynthetic process No
GO:0005575 cellular_component No
GO:0005198 structural molecule activity No
GO:0043043 peptide biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043604 amide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5314
MPASTPPTRTSSPGRRRVGPEEMSSTKAKKPSGKAQRSAIADVVAREYTINMHKRLHGVSFKKRAPRAIKEIKAF
ATKSMGTSDVRIDPQLNKKVWECGVKGVPFKLRVRISRRRNDEEDAKEKLYSYVQAVNVKNPKGLSTVIVEE
Coding >Ophio5|5314
ATGCCAGCCTCCACACCACCGACGAGGACCTCATCGCCAGGCAGACGAAGAGTCGGACCCGAAGAAATGTCGTCG
ACCAAGGCAAAGAAGCCCAGCGGCAAGGCTCAACGCTCCGCCATCGCGGACGTTGTTGCCCGCGAGTACACCATC
AATATGCACAAGAGGTTACACGGCGTCTCCTTCAAAAAGAGGGCTCCGCGCGCCATCAAGGAGATCAAGGCGTTT
GCTACCAAGTCCATGGGCACCTCGGACGTCCGCATCGACCCTCAGCTCAACAAAAAGGTGTGGGAGTGCGGTGTC
AAGGGTGTCCCCTTCAAGCTCCGTGTCCGCATCTCGCGCCGACGAAACGACGAGGAGGACGCAAAGGAGAAGCTG
TACAGCTACGTGCAGGCGGTCAACGTCAAGAACCCCAAGGGCCTTTCCACCGTCATTGTCGAGGAA
Transcript >Ophio5|5314
ATGCCAGCCTCCACACCACCGACGAGGACCTCATCGCCAGGCAGACGAAGAGTCGGACCCGAAGAAATGTCGTCG
ACCAAGGCAAAGAAGCCCAGCGGCAAGGCTCAACGCTCCGCCATCGCGGACGTTGTTGCCCGCGAGTACACCATC
AATATGCACAAGAGGTTACACGGCGTCTCCTTCAAAAAGAGGGCTCCGCGCGCCATCAAGGAGATCAAGGCGTTT
GCTACCAAGTCCATGGGCACCTCGGACGTCCGCATCGACCCTCAGCTCAACAAAAAGGTGTGGGAGTGCGGTGTC
AAGGGTGTCCCCTTCAAGCTCCGTGTCCGCATCTCGCGCCGACGAAACGACGAGGAGGACGCAAAGGAGAAGCTG
TACAGCTACGTGCAGGCGGTCAACGTCAAGAACCCCAAGGGCCTTTCCACCGTCATTGTCGAGGAATAA
Gene >Ophio5|5314
ATGGTGGCTTCTGATTGGCTCGCTAGCCCTAGCACCTCACACTGGCTGCGCACAAAGAATCATTTTTTTTAGCCA
GCCTCCACACCACCGACGAGGACCTCATCGCCAGGCAGACGAAGAGTCGGACCCGAAGGTACGAACACCGCAACA
TCGCTTCTGTTTTCCCACTGCAGGAACCTTCGCGAACTCTACACTCCCTTCAAATCTCACCACGACGTTGCCGTC
ACCCGTCCTCGACAGCAGACACCAACTGACACGCCCTATAGAAATGTCGTCGACCAAGGCAAAGAAGCCCAGCGG
CAAGGCTCAACGCTCCGCCATCGCGGACGTTGTTGCCCGCGAGTACACCATCAATATGCACAAGAGGGTATGTCC
TGGCTGAGGAAAACAACATGAGGCGGTTGCCGCGAGGGCTGACGGAGCTGTTGGTAAAAGTTACACGGCGTCTCC
TTCAAAAAGAGGGCTCCGCGCGCCATCAAGGAGATCAAGGCGTTTGCTACCAAGTCCATGGTAAGGATATCGTGG
TCGCTAGAACGACACCCTTCAAGGCGGCGCTGACACGACCGCCTAGGGCACCTCGGACGTCCGCATCGACCCTCA
GCTCAACAAAAAGGTGTGGGAGTGCGGTGTCAAGGGTGTCCCCTTCAAGCTCCGTGTCCGCATCTCGCGCCGACG
AAACGACGAGGAGGACGCAAAGGAGAAGCTGTACAGCTACGTGCAGGCGGTCAACGTCAAGAACCCCAAGGGCCT
TTCCACCGTCATTGTCGAGGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail