Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|5313
Gene name
Locationscaffold_430:7033..8257
Strand-
Gene length (bp)1224
Transcript length (bp)1089
Coding sequence length (bp)1086
Protein length (aa) 362

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00615 RGS Regulator of G protein signaling domain 1.0E-08 170 239

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7S8|RAX1_SCHPO Protein rax1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rax1 PE=3 SV=1 22 362 2.0E-50
sp|Q08760|RAX1_YEAST Bud site selection protein RAX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAX1 PE=1 SV=1 16 362 1.0E-33

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 252 274 22
2 281 303 22
3 336 358 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 204.72 107.67 301.76
CcL In ants, during behavior modification 157.00 83.67 230.32
CcD In ants, recently dead 166.52 88.96 244.09

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.270400 no
SC16a CcD 0.403818 no
CcL CcD 0.837848 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|5313
MATNMAPASPSPQPDLSRNRLPTLFEVLSRRTLPPVDLFSFYIYMRDQQRSVDYLDFWLDVAQHMSLCRHYVREL
RRSVLVATPDVDKAGSKRSSGILESLGDLEPRAAGPSMYASEKERDQDAQMSAFLREDQPHDSPHSGSGVVRPSP
QYSTPRDVTDSNSPSHTVARQDIRASAEKILYTFLLPGAEREITLPGSITQDVTAAIEDQGRDDPEVFDVAKDYV
FQAMERDAFPGFLRMKALGNLIPPTLVMRLIIGLVSMFGAFWAGFVLIFLDSWRATRCWLILPFTVGVYFLASYQ
YSLDPIMALVGFSEYTPFNFSSIREPYVRQLLAKRAVMVLAVTLLVDAALCLLFILVPGKRL
Coding >Ophio5|5313
ATGGCGACCAATATGGCCCCGGCGAGTCCGTCGCCACAGCCCGACCTTTCGCGCAACAGACTTCCCACTCTCTTC
GAAGTGCTGAGCCGCCGCACGCTTCCGCCCGTCGATCTCTTCTCCTTTTACATTTACATGCGCGACCAGCAGCGC
TCGGTCGATTACCTCGATTTTTGGCTGGATGTGGCCCAACACATGTCTCTGTGCCGTCATTATGTGCGCGAGCTC
CGACGATCTGTCCTTGTGGCCACGCCCGACGTCGACAAGGCCGGCTCCAAGAGGTCGTCGGGCATCCTCGAGAGC
CTGGGCGATCTTGAGCCGCGTGCCGCCGGCCCCTCCATGTACGCGTCCGAAAAGGAGAGGGATCAGGACGCGCAG
ATGTCGGCCTTTTTGCGCGAGGATCAGCCCCATGACTCTCCCCACAGCGGCTCCGGCGTCGTCCGGCCGAGCCCG
CAGTACAGCACGCCCCGCGACGTGACCGACTCCAACTCGCCCTCGCATACCGTCGCCCGCCAGGACATCCGCGCC
TCGGCCGAGAAGATCCTCTACACCTTTCTGCTACCGGGCGCCGAGCGGGAGATTACACTACCCGGATCCATCACT
CAAGACGTCACCGCCGCCATCGAGGACCAAGGCCGCGACGACCCGGAGGTCTTTGACGTGGCCAAGGACTATGTC
TTCCAGGCCATGGAAAGAGACGCCTTTCCGGGCTTCCTTCGCATGAAGGCCCTGGGCAACCTGATCCCCCCGACG
CTCGTGATGCGGCTCATCATCGGCCTCGTCTCCATGTTTGGCGCCTTCTGGGCTGGCTTCGTCCTCATCTTTCTC
GATAGCTGGCGCGCCACGAGGTGCTGGCTCATATTGCCCTTCACCGTCGGCGTCTACTTCCTCGCCTCGTACCAG
TATTCCCTGGACCCCATCATGGCCCTGGTCGGCTTCAGCGAGTACACGCCCTTCAACTTCTCGAGCATACGGGAG
CCCTACGTCCGTCAGCTCCTCGCCAAGCGCGCCGTCATGGTCCTCGCCGTGACTTTGCTCGTCGACGCTGCCCTC
TGCCTGCTCTTCATCCTCGTGCCTGGCAAGCGGCTT
Transcript >Ophio5|5313
ATGGCGACCAATATGGCCCCGGCGAGTCCGTCGCCACAGCCCGACCTTTCGCGCAACAGACTTCCCACTCTCTTC
GAAGTGCTGAGCCGCCGCACGCTTCCGCCCGTCGATCTCTTCTCCTTTTACATTTACATGCGCGACCAGCAGCGC
TCGGTCGATTACCTCGATTTTTGGCTGGATGTGGCCCAACACATGTCTCTGTGCCGTCATTATGTGCGCGAGCTC
CGACGATCTGTCCTTGTGGCCACGCCCGACGTCGACAAGGCCGGCTCCAAGAGGTCGTCGGGCATCCTCGAGAGC
CTGGGCGATCTTGAGCCGCGTGCCGCCGGCCCCTCCATGTACGCGTCCGAAAAGGAGAGGGATCAGGACGCGCAG
ATGTCGGCCTTTTTGCGCGAGGATCAGCCCCATGACTCTCCCCACAGCGGCTCCGGCGTCGTCCGGCCGAGCCCG
CAGTACAGCACGCCCCGCGACGTGACCGACTCCAACTCGCCCTCGCATACCGTCGCCCGCCAGGACATCCGCGCC
TCGGCCGAGAAGATCCTCTACACCTTTCTGCTACCGGGCGCCGAGCGGGAGATTACACTACCCGGATCCATCACT
CAAGACGTCACCGCCGCCATCGAGGACCAAGGCCGCGACGACCCGGAGGTCTTTGACGTGGCCAAGGACTATGTC
TTCCAGGCCATGGAAAGAGACGCCTTTCCGGGCTTCCTTCGCATGAAGGCCCTGGGCAACCTGATCCCCCCGACG
CTCGTGATGCGGCTCATCATCGGCCTCGTCTCCATGTTTGGCGCCTTCTGGGCTGGCTTCGTCCTCATCTTTCTC
GATAGCTGGCGCGCCACGAGGTGCTGGCTCATATTGCCCTTCACCGTCGGCGTCTACTTCCTCGCCTCGTACCAG
TATTCCCTGGACCCCATCATGGCCCTGGTCGGCTTCAGCGAGTACACGCCCTTCAACTTCTCGAGCATACGGGAG
CCCTACGTCCGTCAGCTCCTCGCCAAGCGCGCCGTCATGGTCCTCGCCGTGACTTTGCTCGTCGACGCTGCCCTC
TGCCTGCTCTTCATCCTCGTGCCTGGCAAGCGGCTTTGA
Gene >Ophio5|5313
ATGGCGACCAATATGGCCCCGGCGAGTCCGTCGCCACAGCCCGACCTTTCGCGCAACAGACTTCCCACTCTCTTC
GAAGTGCTGAGCCGCCGCACGCTTCCGCCCGTCGATCTCTTCTCCTTTTACATTTACATGCGCGACCAGCAGCGC
TCGGTCGATTACCTCGATTTTTGGTAGGTCGTCTGGTGATTTCGGCGCCAATGAACCCTCCGCGGCCGCTGACGT
GCTTACTCCAGGCTGGATGTGGCCCAACACATGTCTCTGTGCCGTCATTATGTGCGCGAGCTCCGACGATCTGTC
CTTGTGGCCACGCCCGACGTCGACAAGGCCGGCTCCAAGAGGTCGTCGGGCATCCTCGAGAGCCTGGGCGATCTT
GAGCCGCGTGCCGCCGGCCCCTCCATGTACGCGTCCGAAAAGGAGAGGGATCAGGACGCGCAGATGTCGGCCTTT
TTGCGCGAGGATCAGCCCCATGACTCTCCCCACAGCGGCTCCGGCGTCGTCCGGCCGAGCCCGCAGTACAGCACG
CCCCGCGACGTGACCGACTCCAACTCGCCCTCGCATACCGTCGCCCGCCAGGACATCCGCGCCTCGGCCGAGAAG
ATCCTCTACACCTTTCTGCTACCGGGCGCCGAGCGGGAGATTACACTACCCGGATCCATCACTCAAGACGTCACC
GCCGCCATCGAGGACCAAGGCCGCGACGACCCGGAGGTCTTTGACGTGGCCAAGGACTATGTCTTCCAGGCCATG
GAAAGAGACGCCTTTCCGGGCTTCCTTCGCATGAAGGCCCTGGGCAACCTGATCCCCCCGACGCTCGTGATGCGG
CTCATCATCGGCCTCGTCTCCATGTTTGGCGCCTTCTGGGCTGGCTTCGTCCTCATCTTTCTCGATAGCTGGCGC
GCCACGAGGTGCTGGGTGAGTGTGCCCCGAGTCTTCTTTTCACTCGCCGCCGCAGCACACAGCTGGCTAACCCGT
TTGCACGAAAAGCTCATATTGCCCTTCACCGTCGGCGTCTACTTCCTCGCCTCGTACCAGTATTCCCTGGACCCC
ATCATGGCCCTGGTCGGCTTCAGCGAGTACACGCCCTTCAACTTCTCGAGCATACGGGAGCCCTACGTCCGTCAG
CTCCTCGCCAAGCGCGCCGTCATGGTCCTCGCCGTGACTTTGCTCGTCGACGCTGCCCTCTGCCTGCTCTTCATC
CTCGTGCCTGGCAAGCGGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail